Reach Us +44-1477412632

The use of edible protein films in seafood

Seda Dursun1*, Nuray Erkan2

1Istanbul Üniversitesi, Cerrahpasa Tip Fakültesi, Diyet Hizmetleri Birimi, Istanbul

2Istanbul Üniversitesi, Su ürünleri Fakültesi, Istanbul

*Corresponding Author:
Seda DURSUN
Istanbul Üniversitesi, Cerrahpasa Tip Fakültesi, Diyet Hizmetleri Birimi
Istanbul Kasap Ilyas M. Et Yemez Tekkesi Sok. No: BILA/900 Kocamustafa Pasa-Fatih/Istanbul- TÜRKIYE
Tel: (+90 212) 414 30 00-22683
E-mail: [email protected]
 
Visit for more related articles at Journal of FisheriesSciences.com

Abstract

It is used different conservation and packaging techniques in food industry by delaying enzymatic and microbial spoilage. One of the important development in this issue is edible films and coatings. These materials are made from natural biopolymers and constituted with thin layer on the surface of food. Lipid oxidation is prevented, in addition to water, aromatic components, pigments, ions and vitamins are hold in food by edible films. The most important property of edible films is not carrying cancerogenic risk and don’t cause waste problem, which are serious problems in plastic packaging materials. Edible films can fulfill all the functions of a functional package, if they are properly prepared. It is used generally hydrocolloids (protein and polysaccharides), lipids and composites (hydrocolloids+lipid) in the preparation of edible films. Edible protein films are however classified into two groups as plant origin proteins (such as corn zein, wheat gluten, soy protein, pea protein, sunflower protein, peanut protein and cottonseed protein) and animal origin proteins (such as keratin, collagen, gelatin, fish myofibrillar protein, egg white protein, casein and whey protein). Edible protein films, which are produced from protein isolates or protein consantrates, may be also generated by food processing waste as an evaluation method. The aim of this review is to explain mostly used protein films and to moot that the films are prepared directly from main structure proteins or water soluble proteins (at processing waste) and can applied yet to seafood. So, waste problem is reduced bidirectional and more safety seafoods can producted.

Keywords

Edible films, biodegradable films, protein films, seafood, fish

Giriş

Balık, besleyici bir gıda olarak her zaman önemli sayılmış ve genel diyet önerileri içerisinde yerini daima korumuştur. Balığın bu önemi, esas olarak yüksek değerli protein içeriğinin yanında çoğu balık türünün yağ içeriğinin az olması ve çoklu doymamış yağ asitlerinin ana kaynağını oluşturmasından ileri gelmektedir. Balık ve balık ürünleri çok besleyici özelliklere sahip olmakla birlikte dayanım ömürleri diğer et ve kanatlı etlerine kıyasla oldukça kısadır. Dayanım ömrünü ve kalite özelliklerini korumak için her geçen gün yeni muhafaza teknikleri ve uygulamaları geliştirilmektedir. Bu tekniklerden biri de diğer gıda ürünlerinde de yaygın şekilde kullanılan yenilebilir filmlerden faydalanmaktır.

Yenilebilir film ve kaplamalar; gıdaları korumak, raf ömürlerini uzatmak amacıyla bir gıdanın yüzeyi üzerinde oluşturulmuş ince tabakalı, gıdayla birlikte yenilebilen, sentetik olmayıp doğal kaynaklardan elde edilen maddelerdir.

Yenilebilir filmler uygun şekilde hazırlandığı takdirde fonksiyonel bir ambalajın sahip olabileceği tüm işlevleri yerine getirebilir. Tarımsal kökenli bu ambalajlar, cam, teneke, polimer gibi ticari ambalajlama materyallerine alternatif olarak geliştirilmiştir. Bu tekniğin en önemli işlevlerinden birisi su buharı geçişine karşı gösterdikleri dirençtir. Bu sayede gıda maddelerinin depolanmaları sırasında oluşan ağırlık kayıpları azaltılabilmektedir. Yenilebilir ambalajlarla kaplanmış et ürünlerindeki yağların oksidasyonu engellendi engellendiğinden acılaşmamış, tazeliğini korumuş et ürünlerini market raflarında bulabilmek olasıdır. Kısaca bu ambalajlar, suyun yanı sıra aroma bileşikleri, pigmentler, kararma tepkimelerini durduran iyonlar ve vitaminler gibi maddelerin ürünlerin içinde tutulmasını sağlamaktadır. Ama daha da önemlisi yenebilir film ve kaplamalar, plastiklerle yapılan gıda ambalajlamasının önemli sorunlarından olan kanserojen riskini taşımamakta ve atık sorunu da oluşturmamaktadır (Akbaba, 2006).

Gıda ürünlerinde yenilebilir filmlerin kullanımı yeni gibi görünmekle birlikte bu uygulama yıllar öncesine dayanmaktadır. Vakslar ekşi meyvelerin dehidrasyonunu geciktirmek için, Çin’de 12. ve 13. yy’dan beri kullanılmaktadır. Asya’ da 15. yy’dan beri bazı gıdaların görünüşünü ve muhafazasını geliştirmek için kaynamış soya sütünden elde edilen Yuba ismi verilen filmden yararlanılmaktadır. Büzülmeyi önlemek için etlerin yağlarla kaplanması 16. yy’dan beri uygulanmaktadır. 19. yy’da ceviz, badem ve fındıkların depolanması sırasındaki oksidasyonu ve bozulmayı önlemek için yenilebilir koruyucu bir kaplama olarak ilk kez sükroz kullanılmıştır. Son yüzyılda etlerin ve diğer gıda kaynaklarının korunması için jelatin filmlerle kaplanması önerilmiştir. Şimdiye kadar yenilebilir film ve kaplamaların en önemli uygulaması, 1930’dan beri uygulanan yağ ve vakslardan yapılan bir emülsiyonun kullanılmasıdır. Bu emülsiyonlar, meyvelerin parlaklık ve renk gibi fiziksel özelliklerini koru makta, yumuşaklığın, solgunluğun başlamasını geciktirmekte, fungisitlerin taşınmasını önlemekte, olgunlaşmasını daha iyi kontrol etmekte ve su kaybını azaltmaktadır (Debeaufort vd., 1998).

Yenilebilir film ve kaplamalar, tüketim sırasında olumsuz etki yaratmamak için mümkün olduğunca kokusuz, tatsız, renksiz, saydam, berrak olmalı, gıda maddesi ile uyum göstermelidir. Filmler genellikle aşınmaya dayanıklı ve esnek olmalıdır. Farklı fonksiyonel ihtiyaçları (nem bariyeri, gaz bariyeri, su ve lipitte çözünürlük, renk ve görünüş, mekanik özellikler, vb.) karşılayabilmelidirler (Kandemir, 2006). Ayrıca filmlerin yüzey görünümünün iyileştirilmesi ve yapışkanlığının da azaltılması gerekmektedir. Hidrokolloid yapıda olan filmler genellikle lipid veya mumlardan üretilen aynı özellikteki filmlerden daha doğal yapıdadır. Ayrıca, yenilebilir filmlerin üretiminde kullanılmak üzere arzu edilen duyusal kalite değerlerine sahip maddelerden de yararlanılabilir. Bu şekilde üretilen yenilebilir filmler gıdanın renk, lezzet, asitlik, tatlılık ve tuzluluk gibi gıda değerlerinin korunabilmesine yardımcı olmaktadır (Sarıoğlu, 2005).

Film ve kaplamalar oluşum şekilleri ve gıdalara uygulamalarına göre farklılık gösterirler. Yenilebilir kaplamalar sıvı bir film yapıcı solüsyona veya erimiş bileşikler eklenerek doğrudan gıda üzerine bir fırça ile veya püskürtme ile uygulanır, ürünü filme batırma veya filmi ürün üzerine akıtma ile de oluşturulur (Cuq vd.,1995).

Yenilebilir film ve kaplamalar nem, oksijen, karbondioksit, aroma ve yağlara karşı bariyer sağlayan bileşikler içerebilirler. Antimikrobiyaller, antioksidantlar ve aroma bileşenlerinin ilavesiyle gıdanın mekanik ve biyolojik özelliklerini iyileştirebilirler. Yenilebilir filmlerin mekanik özelliklerini arttırmak için film formülasyonlarında gliserin, etilen glikol, sorbitol, mannitol ve polietilen glikol gibi çeşitli plastikleştiriciler kullanılmaktadır. Bu katkı maddeleri genelde düşük molekül ağırlığına sahip küçük moleküllerdir ve polimerlere uygun kaynama sıcaklıklarına sahiptirler. Plastikleştiriciler paketleme sanayinde önemli olan film kırılganlığını düşürmekte ve filmin esnekliğini de arttırmaktadırlar (Garcia vd., 2000).

İyi özellikte yenilebilir film üretimi için aşağıdaki koşulların sağlanması gerekmektedir (Appendini ve Hotchkiss, 2002):

1. Kullanılan ham maddeler genellikle güvenilir kabul edilmiş (GRAS) olmalı,

2. Yavaş, fakat kontrollü ürün solunumuna izin vermeli,

3. Yapısal bütünlük sağlamalı ve mekanik işlemeyi geliştirmeli,

4. Gıda katkı maddelerini birleştirici görev yapmalı,

5. Mikrobiyal bozulmayı uzun depolama süreleri boyunca engellemeli veya azaltmalıdır.

Yenilebilir filmlerin önemli işlevlerinden biri gaz veya daha da sık olarak su buharı için bariyer olarak kullanılabilmeleridir. Su buharı geçirgenliği yenilebilir filmlerin en önemli ve en çok çalışılan bariyer özelliğidir. Gıdalardaki nem seviyeleri, tazeliği korumak, mikrobiyolojik gelişimi kontrol altında tutmak ve ağız dolgunluğu ve görünüm sağlamak için önemlidir. Yenilebilir filmler nem kaybını ya da nemliliği önleyen su aktivitesini kontrol altına almaktadırlar (Krochta ve DeMulder Johnston, 1997).

Yenilebilir film ve kaplamaların bileşiminde bulunan biyolojik kaynaklı polimerler aşağıdaki şekilde sınıflandırılırken (Sarıkuş, 2006), yenilebilir filmlerin hazırlanmasında temelde hidrokolloidler (protein ve polisakkarit), lipidler ve kompozitlerden (hidrokolloid+lipid) yararlanılmaktadır. Yenilebilir filmleri biyolojik kaynaklı yapılarına göre 3 kısımda incelemek mümkündür:

1. Polisakkaritler

a) Nişasta (Patates, mısır, buğday, pirinç ve diğer türevleri)

b) Selüloz (pamuk, odun ve diğer türevleri)

c) Gumlar (guar, lokust bean, aljinatlar, karragenan, pektinler ve diğer türevleri)

d) Kitin/Kitosan

2. Yağlar

a) Çapraz bağlı trigliseridler

b) Vakslar

c) Hayvansal ve bitkisel yağlar

3. Proteinler

a) Hayvansal (kazein, peynir altı suyu, kollajen, jelatin vb.)

b) Bitkisel (zein, soya, gluten vb.)

Yenilebilir Polisakkarit Filmleri

Polisakkarit filmlerin içeriğini, aljinat, kitosan, pektin, agar, karragenan, selüloz türevleri, nişasta, nişasta hidrolizatları, dekstran gibi maddeler oluşturmaktadır. Kahverengi deniz yosunlarından alkali ile muamele edilerek izole edilen aljinatlar, gıda endüstrisinde ve endüstriyel uygulamalarda çok amaçlı olarak kullanılan hidrokolloidlerdendir. Ticari kullanım için üretilen aljinatlar başlıca Macrocystis pyrifera, Laminaria hyberborea, Laminaria digitata ve Ascorphyllum nodosum türlerinden ekstrakte edilmektedir. Amerika Birleşik Devletleri, İngiltere, Fransa, İspanya, Norveç, Kanada ve Japonya dünya genelinde başlıca aljinat üretimi yapan önemli ülkelerdir. Aljinik asit, suda sınırlı çözünmesine rağmen, suyu iyi absorbe eden bir maddedir. Dondurma, şerbet ve peynirlerde stabilizatör, sütlü puding ve jel halindeki sulu tatlılarda jelleştirici, meyveli içecek ve diğer meşrubatlarda süspansiyon oluşturucu ve koyulaştırıcı, birada köpük stabilizatörü, mayonezde emülgatör olarak kullanılmaktadır (Gombotz ve Wee, 1998). Aljinat, yenilebilir film olarak su ürünleri ve et ürünlerinin kaplanmasında da sıklıkla kullanılan materyallerden birisidir (Erickson ve Hung, 1997; Gennadios vd., 1997; Gennadios, 2002; Datta vd., 2008).

Kitosan, yengeç, karides, istakoz gibi eklembacaklıların kabuklarında, bazı bakteri ve mantarların hücre duvarlarında bulunan ve doğada selülozdan sonra en yaygın olarak bulunan polimer olan kitinin (β-(1-4)-poli-N-asetil-Dglukozamin) deasetilasyonu ile elde edilen bir polimerdir. Herhangi bir toksisitesinin bulunmaması, alerji ve iritasyon yapıcı olmamasının yanı sıra, biyoparçalanabilir ve biyogeçimlidir. Kitosan aynı zamanda önemli biyoaktif özelliklere sahiptir. Bunlar arasında hemostatik, bakteriyostatik, fungistatik, film oluşturucu, spermisidal, antikanserojen, antikolesteremik, antiasid, antiülser, yara ve kemik iyileşmesini hızlandırıcı, immün sistem stimülan özellikleri sayılabilir (Duman ve Şenel, 2004).

Kitosanın gıda teknolojisindeki en önemli kullanım şekli film halinde, bilhassa sebze ve meyvelerin kalitelerinin korunması ve depolama süresinin artırılması olmuştur. Yarı geçirgen özellikteki kitosan filminin sert, dayanıklı, esnek ve kolayca yırtılmayan bir materyal olması önemli avantajları olarak değerlendirilmektedir ve bu özellikleri çoğu ticari polimerle yarışabilir niteliktedir. Gıdaların kitosan filmi ile kaplanması ambalaj içindeki kısmi oksijen basıncını azaltmakta, gıda ile çevresi arasındaki nem transferi ile sıcaklığı kontrol altında tutmakta; su kaybını azaltmakta, meyvelerde enzimatik kahverengileşmeyi geciktirmekte, solunumu kontrol etmektedir. Bunlara ilave olarak doğal aromanın arttırılması, tekstürün ayarlanması, emülsifiye edici etkinin artırılması, rengin stabilizasyonu, deasidifikasyon gibi konularda da kitosandan yararlanılmaktadır (Bostan vd., 2007). Kitosan filmleri et ve su ürünlerinin güvenliğinin sağlanmasında da kaplama materyali olarak başarılı bir şekilde kullanılmaktadır (Crackel vd., 1988; Shahidi vd., 2002; Tsai vd., 2002; Lopez- Caballero vd., 2005; Sathivel, 2005; Yılmaz vd., 2006; Gomez-Esteca vd., 2007; Kim vd., 2007).

Pektinler bitkisel kökenli polisakkaritlerden bir gruptur. Metil ester içeriğiyle farklılaşan pektinlerin esterifikasyon derecesi çözünürlük ve jelleşme özelliklerini etkilemektedir. Pektin bazlı filmlerin düşük nemli gıdalarda iyi çalıştığı görülmüştür. Ancak tam anlamıyla bir nem bariyeri değillerdir. Kalsiyum pektinat jel kaplamanın biftek parçalarındaki büzülmeyi ve bakteriyel gelişmeyi azalttığı görülmüştür (Gennadios, 2002).

Kırmızı alglerden elde edilen, genelde mikrobiyolojik medialarda sıkılığı önlemek için kullanılan agar kendisini etlere kaplanması için kullanışlı yapan karakteristikler göstermektedir. Antibiyotikler agar kaplamayla birleştirilirse kaplanan tavuk ürünleri ve bifteklerin raf ömrü uzamaktadır, ancak agar nem kaybını azaltmamaktadır. Bakteriosin olan nisinin agar kaplamaya ilavesi tavuk ürünlerinin yüzeyindeki Salmonella typhimurium seviyesini etkili bir şekilde azaltmıştır (Gennadios, 2002).

Karragenan ise, kırmızı deniz yosunlarından (İrlanda yosunu olarak da adlandırılır) elde edilen bir kıvam artırıcıdır. Ambalajı olduğu gıdada, yapay bir nem bariyeri gibi görev yaparak, ürünün nem kaybını azaltmaktadır (Akbaba, 2006). Gıda uygulamalarında kullanılan karragenan bazlı kaplamalar kappa-(κ), iota-(ι) ve lambda-(λ) polimerlerinden üretilmektedir ve tavuk ürünleri ve balıkların raf ömrünü uzatmak için kullanılmaktadır (Gennadios, 2002).

Filmlerin hazırlanmasında kullanılan en önemli çiğ materyal nişastayla birlikte selüloz ve derivatlarıdır (eter ve esterleri gibi). Metilselüloz (MC), selülozun metilklorid ile reaksiyonundan sonra alkali muamelesiyle oluşan bir selüloz eteridir. Termal jelasyon gösteren MC mükemmel film oluşturucu özelliklere sahiptir ve yenilebilir filmlerin hazırlanmasında yaygın şekilde kullanılmaktadır (Peressini vd., 2003; Turhan ve Şahbaz, 2004). Büyük yüzey alanı ve biyopolimerik yapısından dolayı, üründeki suyun büyük miktarını içine alma yeteneğine sahip olan selüloz içerikli kaplamaların acılaşma üzerine de olumlu etkisi vardır (Akbaba, 2006). Selüloz esterleri yenilebilir filmleri suda çözünen, yağa dirençli, sağlam ve fleksible yapmak için kullanılmaktadır. Plastikleştirici olarak bir yağla kombine edilerek hem taze hem de dondurulmuş etlerin kaplanması için kullanılmaktadır. Metilselüloz veya hidroksi metilselüloz ile etlerin kaplanması; pişirme sırasındaki kaybı minimize etmekte, yağ alımını düşürmekte ve tavuk ürünleri ve su ürünlerine glaze olarak uygulandığında nem kaybını azaltmaktadır (Gennadios, 2002).

Yüksek nemli jelatine kaplamaların oluşumunda selüloz kullanıldığında, kısa süreli depolama sırasında bazı gıdalardan (örneğin; et ürünleri) su kaybı gecikmektedir. Selüloz bazlı filmler yüksek yağlı gıdalar için de yenilebilir oksijen ve su bariyeri olarak kullanılmaktadır. Bu tür filmler oksidasyonu azaltarak ve suyun yeniden absorbe edilmesinin engellenmesiyle derin yağda kızartılan gıdaların gevreklik kaybını yavaşlatarak yüksek yağlı gıdaların raf ömrünü uzatmaktadır (Aydınlı ve Tutaş, 2000). Nişasta ise film içerisine kolayca katılabilen doğal bir polimerdir. Nişasta filmleri kolayca hazırlanmasına karşılık zayıf fiziksel özelliklere sahiptir. Nişasta filmleri yenilebilir ambalajdaki biyobozunur materyalleri veya selüloz derivatları ile proteinleri üretmek için diğer sentetik polimerlerle karıştırılarak geliştirilebilirler (Peressini vd., 2003).

Dekstranlar glikosid bağlarının farklı tipi ve miktarıyla D-glukopiranosil birimlerinden oluşan mikrobiyal gumlardır. Genellikle Leuconostoc mesenteroides ve Leuconostoc dextranium sükroz fermentasyonuyla dekstran biyosentezinden sorumlu olan mikroorganizmalardır. Sıvı solüsyon veya dispersiyon şeklinde uygulanan dekstran kaplalamar soyulmamış karides, soyulmuş karides, balık ve jambon, sosis ve pastırma gibi kırmızı et ürünlerinin buzdolabında veya dondurarak depolama sırasında flavorunu, rengini ve tazeliğini korumak için uygulanmaktadır (Gennadios vd., 1997).

Polisakkarit filmler hidrofilik karakteristikleri nedeniyle zayıf su buharı bariyer özelliklerine sahiptir. Hidrofilik filmlere hidrofobik karakteristikler eklemek için film solüsyonuna balmumu, karnauba mumu, parafin mumu ve yağ asitleri gibi hidrofobik materyaller ilave edilebilir. Film oluşturucu polimerlere eklenen temel materyaller plastikleştiricilerdir. Bu ajanlar intermoleküler güçleri azaltmakta, biyopolimer zincirlerinin hareketliliğini artırmakta ve böylece filmin mekaniksel özellikleri geliştirilmektedir. Plastikleştirici ajanların ilavesi polisakkarit filminin parlaklığını sağlamak için de gereklidir. Diğer taraftan plastikleştiriciler genelde gazların, su buharının ve filmin içerisinde çözünen katı materyallerin transferini artırmaktadır (Aydınlı ve Tutaş, 2000).

Yenilebilir Lipid Filmleri

Yenebilir filmlerin ikinci grubunda, asetillenmiş monogliseritler, doğal mumlar ve çeşitli yağlı bileşikler, koruyucu kaplama olarak kullanılan yağlar bulunmaktadır. Bu tip malzemeler, nem kaybına engel olmalarını sağlayan özellikleri nedeniyle kullanılmaktadırlar. Bu özellikten daha çok beyaz ve kırmızı etleri korumak amacıyla yararlanılmaktadır. Yağlar, kullanıldıkları ürünün solunumunu azaltarak ömrünün uzamasını sağlamakta, ayrıca meyve ve sebzelerde yüzey parlaklığı için önerilmektedirler. Yağlı filmler meyve yüzeyindeki küflenmenin engellenmesinde de etkin bir koruyucudur (Akbaba, 2006).

Lipidler genelde hidrofobiktir, iyi nem bariyeri olarak hareket etmekte ve gıda ürünlerinin görünüşünü geliştirerek parlaklığı da sağlamaktadırlar. Ancak, film oluşumunda çözücü veya yüksek sıcaklık gerektirmekte ve zayıf mekaniksel özellikler sergilemektedirler. Gaz ve buhar geçişine karşı sıvı haldeki lipidler katı haldekilere göre daha az direnç göstermektedir. Birçok lipid kristalin formda bulunmaktadır. Bireysel kristaller gazlara ve su buharına karşı oldukça geçirimsizdir, ancak kristaller arasında geçişler olabilir. Kristalin lipidlerin bariyer özellikleri, interkristalin bağlanma dizilişine oldukça bağlıdır. Kristalin oryantasyonu ve lipid tipi de geçirgenliği etkilemektedir (McHugh, 2000). Yenilebilir vakslar su buharı migrasyonuna karşı diğer lipid filmlerden veya lipid olmayan filmlerden daha dirençlidir. Vaks kaplamaların bu büyük direnci hem hidrofobik karakterleriyle hem de moleküler organizasyonlarıyla ilişkilidir (Callegarin vd., 1997). Lipidler genelde filmlerin mekaniksel özelliklerinde etkili değildir, fakat bazıları (asetogliseridler, yağ asitleri, monogliseridler, fosfolipidler) plastikleştirici olarak formülasyonda sıklıkla kullanılmakta ve bitişik polimer zincirleri arasındaki intermoleküler güç lerin zayıflamasıyla uzayabilirliği artırmaktadırlar (Callegarin vd., 1997).

Lipid kaplamalar dış ortamla ürün arasındaki nem değişimini (alma veya kaybetme) geciktirmek için konfeksiyoner ürünlere, taze meyve ve sebzelere uygulanmaktadır. Lipidler yüksek moleküler ağırlıklı polimerlerle birlikte nem değişimine karşı hassas olan gıda materyallerinin mikroenkapsülasyonu için de kullanılmaktadır. Oksidasyona karşı hassas olan gıda komponentlerinin enkapsülasyonu için kullanılan lipid bazlı filmlerin oksijen bariyer karakteristikleri de önemlidir. Ayrıca, ince lipid kaplama, taze meyve ve sebzelerin yüzeyine uygulandığında O2 akışını sınırlandırır ve kurumayı geciktirir. Bu kaplamalar aerobik solunumun oranını baskılamakta ve bu baskı uygun dereceye geldiğinde son ürünün depolanma ömrü uzamaktadır (Kester ve Fennema, 1989).

Taşıma ve depolama sırasında kurumayı ve oksidasyonu kontrol yeteneği (özellikle tropikal meyveler için), çürüme kontrolü ve büyüme düzeni için fungusitlerle birleşmesi, yüzeye parlaklık vererek görünüşü geliştirmesi ve sınırlı raf ömrüne sahip gıda maddelerinin market ömrünü uzatmaya yardım eden ürün fizyolojisinin görünüşünü kontrol etmesi gibi nedenlerle taze meyve ve sebzelerin lipidlerle kaplanması ile ilgili literatürde birçok çalışma bulunmaktadır (Callegarin vd., 1997).

Lipid filmler mekaniksel özellikleri güçlü fakat su buharı bariyer özellikleri zayıf olan yenilebilir filmlerle birlikte kompozit filmlerin hazırlanmasında kullanılmış ve filmlerin fonksiyonel özellikleri daha da geliştirilmiştir. Kazein ve jelatinin sıvı solüsyonlarına asetillenmiş monogliserid, stearik asit, palmitik asit, balmumu ve karnauba mumunun etanolik solüsyonlarının ilave edilmesiyle emülsifiye filmler geliştirilmiştir (McHugh, 2000). Lipid içeren kompozit filmler çok iyi bariyer özelliklerine sahip olmuş, fakat parlak bir renk ve mumsu bir tat sergilemişlerdir (Callegarin vd., 1997, Mc Hugh, 2000).

Yenilebilir Protein Filmleri

Yenilebilir protein filmleri bitkisel kökenli proteinler (mısır zeini, buğday gluteni, soya proteini, bezelye proteini, ayçiçeği proteini, yer fıstığı proteini ve çiğit proteini gibi) ve hayvansal kökenli proteinler (keratin, kollajen, jelatin, balık miyofibriler proteini, yumurta beyazı proteini, kazein ve peynir altı suyu proteini) olarak iki gruba ayrılmaktadır.

Protein kaynaklı filmlerin mekaniksel ve bariyer özellikleri polisakkarit kaynaklı filmlerden genelde daha iyidir. Homopolimer olan polisakkaritlerle karşılaştırıldığında, genel fonksiyonel özelliklerin geniş bir çeşidini, özellikle yüksek intermoleküler bağlama potansiyelini içeren proteinler spesifik bir yapıya (20 farklı monomere bağlı olan) sahiptirler (Sabato vd., 2007).

Protein filmleri bir çözücünün ilavesiyle polipeptid zincirlerinin kısmi denatürasyonu, pH değişimi, çapraz bağlanmayı sağlayan bir elektrolitin eklenmesi ve/veya ısı uygulanması sayesinde oluşmaktadır (Rhim ve Eg, 2007). Protein yapısındaki filmlerin özellikleri; protein kaynağı, protein solüsyonunun pH’sı, plastikleştirici, film kalınlığı, hazırlama şartları ve film oluşturucu solüsyon içine dahil olan yapılar gibi çeşitli faktörlere bağlıdır (Benjakul vd., 2008). Proteinlerden elde edilen filmler kaplandıkları gıdanın besin değerini oldukça artırmaktadırlar.

Mısır proteini (zein) filmi

Mısır endosperminde bulunan zein proteininden hazırlanan yenebilir filmler kırılgan bir yapıda olduğundan öncelikle esnekleştirilmekte; yani plastikleştirilmektedir. Zein filmleri, kullanıldığı ürün üzerinde sert, parlak, mikroorganizma etkinliğini engelleyen koruyucu bir tabaka oluşturmaktadır. Zein kaplamalar domateslerin üzerindeyken, sebzenin parlaklık ve nem kaybını azaltmaktadır, renk değişimini de geciktirmektedir. Yine peynirler üzerinde uygulandığında, peynirlerin yüzeyine koruyucu olarak uygulanan sorbik asidi korumaktadır. Böylece, bir anlamda koruyucunun koruyucusu olmaktadır (Akbaba, 2006).

Zein, hidrofobik yapıda olduğundan su absorpsiyon özelliği yüksek su aktivitesinde yüksek, düşük su aktivitesinde ise aşırı derecede düşük olmaktadır. Su absorbsiyonu açısından zein tozu ve plastikleştirilmemiş filmler arasında önemli farklar gözlemlenmemiştir. Gliserolle plastikleştirilmiş filmlerin su absorbsiyonu 0.7’nin altındaki su aktivitesinde en düşük iken, zein tozu ve plastikleştirilmemiş filmler için su absorbsiyonu 0.8’in altındaki su aktivitelerinde en düşük düzeydedir. Gliserolle plastikleştirilmiş filmler yüksek su aktivitesinde, plastikleştirilmemiş filmlerden beş kat daha fazla su absorbsiyon kapasitesine sahiptir. Plastikleştirilmiş filmlerin daha yüksek su tutma kapasiteleri gliserolün hidrofilik özelliklerine bağlıdır. Polietilen glikol veya laktik asit ile plastikleştirilmiş filmler gliserolle plastikleştirilmiş filmlerden daha düşük su absorbsiyonuna sahiptir. Zein kaplamaları fındık, şeker, şekerleme ürünleri başta olmak üzere diğer gıdalar için oksijen, lipid ve nem bariyeri olarak kullanılmaktadır. Vitamin ve minerallerle zenginleştirilmiş pirinçlerin soğuk suda yıkama esnasında vitamin ve mineral kayıplarını azaltmak için zein-stearik asit-odun reçinesi ile kaplanmaktadır (Temiz ve Yeşilsu, 2006).

Buğday proteini (gluten) filmi

Buğday gluteni, buğday nişastası üretiminde ortaya çıkan bir yan üründür. Yüksek molekül ağırlığı, yaygın apolar karakteri ve fraksiyonlarının çeşitliliği en önemli özellikleri arasındadır. Buğday gluteninden seçici gaz bariyer özelliği gibi orjinal özelliklere ve kauçuk benzeri mekanik özelliklere sahip filmler yapılabilmektedir. Buğday gluteni esaslı filmler homojen, saydam, mekanik olarak güçlü ve nispeten su dayanımına sahiptirler. Bu filmler gıda esaslı katkı maddeleri kullanıldığı ve kirletici maddeler kullanılmadığı zaman yenilebilmektedirler. Buğday gluteni esaslı filmlerin nem bariyer özellikleri (su buharı geçirgenliği) alçak yoğunluklu polietilen gibi sentetik filmlerle karşılaştırıldığı zaman nispeten düşüktür. Buğday gluteni filmlerinin bariyer özellikleri, film yapısına yağlı bileşenlerin ilave edilmesiyle polietilen filmin özelliklerine benzetilebilmektedir (Temiz ve Yeşilsu, 2006).

Buğday gluten filmine sistein eklenmesiyle filmin gerilme direnci artmaktadır (Rayas vd., 1997). Gliserolle plastikleştirilmiş buğday gluten filmlerinin mekaniksel ve fiziksel özellikleri farklı sıcaklıklarda (20 °C, 50 °C ve 80 °C ) ve relatif nemde (% 35 ve % 70) incelendiğinde, % 35 nispi nemde kurutma sıcaklığı arttığında gerilme gücünün de arttığı görülmüştür. % 70 nispi nemde sıcaklık arttığında ise gerilme gücü azalmaktadır. Filmlerin kalınlığı sıcaklığın artmasıyla azalmaktadır. Filmin 50 °C’de ve % 70 nispi rutubette kurutulmasının dışında % 1.5 sodyum dodesil sülfat eklenmesi bütün filmlerin çözünürlüğünü artırmıştır (Kayserilioğlu vd., 2003).

Soya proteini filmi

Soya protein izolatı, filmlerin yapımında ham materyal olarak yaygın bir şekilde kullanılan en önemli proteinlerden biridir. Soya proteini yenilebilen ürünler için uygulanabilen ve biyolojik olarak parçalanabilen çevre dostu bir üründür. Film oluşum mekanizmasının, film ve hava arasında protein polimerizasyonu ve solvent ektraksiyonu vasıtasıyla meydana geldiğine inainanılmaktadır. Film ağındaki protein molekülleri disülfit, hidrofobik ve hidrojen bağları vasıtasıyla birleşmiş durumdadır. Disülfit bağları asıl olarak protein polimerizasyonundan sorumludur (Temiz ve Yeşilsu, 2006).

Soya protein izolatı, stearik asit ve pullulanın kombinasyonundan oluşan optimum yenilebilir bir film kivilerin korunması için kullanılmış ve kaplanmış kivilerde olgunlaşma işleminin yavaşladığı, 37 günlük depolama süresince kaplanmış ve kaplanmamış kivilerin yumuşama oranlarının sırasıyla %29-%100 olduğu ve böylece kivilerin kaplanmasıyla depolama sürelerinin 3 kattan daha fazla arttığı tespit edilmiştir (Temiz ve Yeşilsu, 2006).

Tam soya unu ve elma pektini kombinasyonunun hidrokolloid yenilebilir film üretimi için hammadde olarak kullanıldığı bir çalışmada en iyi yoğunluktaki filmleri elde etmek için iki bileşen arasındaki oran “2:1 mg/cm2, pektin-soya unu” olarak belirlenmiştir. Filmler soya polipeptid zincirleri arasında izopeptid bağlarını üreten enzim olan transglutaminaz varlığında da hazırlanmıştır. Mikro-yapısal analizlere göre bu filmin daha yumuşak yüzeye ve daha yüksek homojeniteye sahip olduğu görülmüştür. Filmin mekaniksel özellikleri incelendiğinde transglutaminazın gerilme gücünü ve esnekliğini artırdığı tespit edilmiştir. Bu sayede transglutaminazla polimerize edilmiş pektin-soya proteini filminin yenilebilir gıda ve ilaç kaplama materyali olarak kullanımının mümkün olacağı sonucuna varılmıştır (Mariniello vd., 2003).

Bezelye proteini filmi

Bezelye farklı fonksiyonel özellikleri ve yüksek besinsel değerinden dolayı gıda endüstrisinde kullanılan, baklagil familyasına ait protein kaynaklarından biridir. Kurutulmuş bezelyeler genel olarak karbonhidrat (%35), protein (%27) ve çok az miktarda da lipid içermektedir. Bezelye protein konsantresi ve izolatı iyi bir besinsel kaliteye sahiptir ve diyetlerin proteince zenginleştirilmesinde sıklıkla kullanılmaktadır (Temiz ve Yeşilsu, 2006).

Yapılan çalışmalara göre; gliserol gibi plastikleştiricilerin konsantrasyonunun artması, filmin kopması için gerekli uzunluğu (belirli bir uzunluktaki materyalin koptuğu andaki % uzama oranı) artırırken, gerilme gücünü ve elastik modülesini azaltmıştır. Diğer yenilebilir protein filmlerinde olduğu gibi 95°C’de 25 dakika ısı denatürasyonu bezelye protein konsantresi film lerinin kuvvetini artırmaktadır. Bezelye protein konsantrelerinin kuru filmine % 40’a kadar plastikleştiricilerin ilave edilmesi su buharı geçirgenliklerini etkilememiş, sadece %50/%50 oranında film ve plastikleştiricinin kullanılması, su buharı geçirgenliğini önemli derecede yükseltmiştir (Temiz ve Yeşilsu, 2006). Bezelye protein izolatının alkalin dispersiyonundan protein filmi hazırlamak için plastikleştirici olarak polioller kullanılmıştır. Plastikleştiricinin zincir uzunluğunun artması biraz daha yüksek hidrofobisiteye, fakat zayıf mekaniksel özelliklere neden olmaktadır. Film oluşturucu solüsyona monogliseridlerin eklenmesi filmlerin önemli derecede geliştirilmesini sağlamıştır. Protein çözücü ajan olarak sodyum hidroksit yerine amonyum hidroksitin kullanılması gerilme direncini ve yüzey hidrofobisitesini artırmaktadır (Viroben vd., 2000).

Pamuk tohumu proteini filmi

Protein izolatlarının aksine pamuk tohumu unu esaslı çözeltilerden film oluşturmak için gerekli şartların belirlenmesi oldukça zordur. Çünkü ham materyal protein, lipid, kül, selüloz ve karbonhidrat gibi maddelerden oluştuğundan oldukça komplekstir. Bu proteinden üretilen filmin yapışkanlığı polimer yapısına, film oluşturma işlemlerine, sıcaklığa, basınca, solvent tipine, katı madde solvent oranına, film uygulama teknolojisine, plastikleştiricilerin varlığına, hacim oluşturma ve çapraz bağlanma ajanlarına bağlıdır. Pamuk tohumu unlarından elde edilen filmler protein içeriklerinden dolayı yüksek hidrofilik özelliğe sahiptirler. Protein esaslı filmlerin mekanik özellikleri hem sıcaklık hem de nispi nem tarafından etkilenmektedir. Su protein ağlarında moleküler hareketliliği artırarak ve filmin mekanik özelliklerini değiştiren sıcaklığı azaltarak pamuk tohumu unu filmlerinde bir plastikleştirici olarak görev yapmaktadır. Pamuk tohumu filmleri iyi mekanik dayanım ve suda çözünmemeye ihtiyaç duyulan gıda olmayan paketlemenin belirli uygulamaları için kullanılabilir. Bu filmler ürünleri korumak, tohumları kaplamak ve su kaybını önleyici paketler olarak da kullanılırlar. Bu uygulamalarda film rengi, gözenekliliği ve biyolojik olarak parçalanabilirliliği önemlidir. Su kaybını önleyici filmler başlangıç görevlerini yerine getirdikten sonra doğal gübre olarak da kullanılabilirler (Temiz ve Yeşilsu, 2006).

Pamuk tohumu proteinlerinin termoplastik makromoleküllere benzediği ve bu yüzden düşük nem teknolojisiyle üretilmeye uygun olduğu görülmüştür. Mekaniksel ve termal analizlere göre pamuk tohumu proteinlerinin özellikleri üzerinde gliserol iki önemli etkiye sahiptir. Birinci etkisi plastikleştirici olarak kullanılması, ikincisi ise gliserolün fazla bir miktarıyla karıştırıldığında termal denatürasyona karşı daha stabil hale gelmesidir (Grevellec vd., 2001).

Pamuk tohumu proteinleri çoğunlukla suda çözünen globulin ve albuminlerle karıştırılır. Pamuk tohumu filminin mekaniksel özelliklerini geliştirmek ve çözünürlüğünü artırmak için amino asit zincirleriyle tepkimeye giren bifonksiyonel belirteçlerle kimyasal olarak muamele edilmesi düşünülmüştür. Pamuk tohumu proteinlerinin gossipol, formaldehit ve glutaraldehit ile kimyasal modifikasyonu delinme gücünü artırmak ve çözünürlüğü azaltmak için kullanılmaktadır (Marquie vd., 1995).

Ayçiçeği proteini filmi

Yağ endüstrisinden açığa çıkan genellikle hayvan yemi olarak kullanılan ayçiçeği yağ keki ucuz bir protein kaynağıdır ve % 30’u proteindir. Bu proteinlerden alkali ekstraksiyonuyla birçok albumin ve globulinden oluşan protein izolatı üretilebileceği görülmüştür. Üretilen izolat % 85 oranında protein içermektedir (Orliac ve Silvestre, 2003). Elde edilen izolatın film oluşturma potansiyeli incelendiğinde; protein çözünürlüğünün, bazların ve plastikleştiricilerin seçiminin ayçiçeği protein filminin mekanik özelliklerini etkilediği ifade edilmiştir. Film özelliklerini belirleyen protein-protein interaksiyonları plastikleştiricinin varlığıyla şekillenmektedir. Film oluşturucu solüsyona plastikleştiricilerin eklenmesi zorunludur. Plastikleştirici eklenmediği takdirde protein ağları işlenmek için çok gevrek olmaktadır. Proteini çözmek için kullanılan baz, filmlerin özellikleri üzerinde oldukça etkilidir. Nonkovalent bağlarla birleşen iyonik bazlar gerilme direncini ve elastikliği artırmaktadır (Ayhllon-Meixueiro vd., 2008). Plastikleştiricilerden gliserol kırılmaya karşı en büyük direnci gösterirken, trietilen glikol en yüksek gerginliği göstermiştir (Orliac ve Silvestre, 2003).

Yerfıstığı proteini filmi

Yerfıstıkları biyopolimerik filmler için önemli bir komponenttir. Yerfıstığının tohumu % 45 lipid ve % 22-33 protein içermektedir. Tohumların aflatoksinle kontamine olması nedeniyle büyük ürün kayıpları, kararsız hava şartları ve uygunsuz işleme yöntemleri (örneğin kızartma) ürünün değerinin ve hayvan yemi olarak kulla nımının azalmasına neden olmuştur. Bu amaçla insan tüketimi için uygun olmayan yerfıstığı tohumlarındaki proteinleri değerlendirmek için alternatif kullanım olanakları geliştirilmiştir. Bunlardan birisi de yerfıstığı proteinlerinden yenilebilir filmler üretmektir (Liu vd., 2004).

Kurutma sıcaklığı ve film oluşturucu solüsyonun pH’sı yerfıstığı protein filmlerinin fizikokimyasal ve geçirgenlik özelliklerini etkilemektedir. Yüksek sıcaklıkta (90 ºC) üretilen filmler düşük nem içeriği ve su aktivitesi sergilemektedir. Film rengi, pH ve kurutma sıcaklığına bağlı olarak açık sarıdan koyu sarıya kadar değişmektedir. Sıcaklık yükseldiğinde film çözünürlüğü ve protein çözünürlüğü azalmakta, fakat pH’nın yükselmesiyle artmaktadır. Filmin gerilme gücü ve uzaması yükselen sıcaklıkla artarken su buharı ve oksijen geçirgenliği azalmaktadır. Su buharı ve oksijen geçirgenliği ile gerilme gücü pH tarafından etkilenmezken, filmin uzaması yükselen pH ile artmaktadır. pH 9.0 ve 90 ºC’deki ekstrem koşullarda en düşük geçirgenliğe sahip filmler oluşturulmuştur (Jangchud ve Chinnan, 1999a).

Dört farklı plastikleştirici çeşidinin (gliserin, sorbitol, polietilen glikol ve propilen glikol) üç farklı seviyesinde (protein içeriğine göre 0.67 g/g, 1.17 g/g, 1.67 g/g ) üretilen yerfıstığı protein filmleri arasında en iyi performansı gliserin ile üretilen filmler göstermiştir. Gliserin konsantrasyonu da filmlerin mekaniksel ve geçirgenlik özelliklerini etkilemiştir. Yerfıstığı proteinleri oldukça hidrofilik olduğu için artan relatif nemle birlikte denge nem içerikleri belirgin şekilde artmaktadır. Filmlerin kalınlığı da relatif neme bağlı olarak değişmektedir (Jangchud ve Chinnan, 1999b).

Liu ve arkadaşları (2004) tarafından yürütülen bir çalışmada yerfıstığı tohumlarından elde edilen protein filmlerinin özelliklerinin fiziksel ve kimyasal muamelelerle değiştiği tespit edilmiştir. Filmin rengi, mekaniksel direnci, suda çözünürlüğü, su buharı ve oksijen geçirgenliği bu değişimden etkilenmektedir. Filmin özelliklerindeki değişimleri tespit etmek için uygulanan fiziksel muamele film oluşturucu solüsyonun 60°C, 70°C, 80°C ve 90°C’de 30 dk ısıyla denatürasyonu, filmlerin 24 saat UV ışınlanması ve film oluşturucu solüsyonun üç ultrasoundlu işleminden oluşmaktadır. Kimyasal muamele ise aldehit ve anhidlerin eklenmesidir. 70°C’de ısı muamelesi, 24 saatlik UV ışınlama, su banyosunda 10 dk ultrasound ve formaldehit ve glutaraldehit ilavesi filmlerin gerilme gücünü önemli derecede artırmaktadır. Su buharı ve oksijen geçirgenliği ısıyla denatürasyondan ve aldehit muamelesinden sonra azalmaktadır. Oksijen geçirgenliği UV muamelesiyle de azalmaktadır. Isı muamelesi en etkili uygulamadır, uygulanan ısı sayesinde filmler daha güçlü, suya karşı daha dirençli ve su buharı ve oksijen geçirgenlikleri ise en az olmaktadır.

Pirinç proteini filmi

Pirinç proteinleri yüksek derecede hipoallerjenik ve çok iyi besleyici değere sahip olmasıyla eşsizdir. Son zamanlarda pirinç kepeği protein solüsyonlarından ve pirinç proteini ile pullulanın bir kombinasyonundan yapılan dispersiyonlardan oluşturulan, ardından kurutulan pirinç bazlı yenilebilir filmlerin hazırlanması ve karakterizasyonu konularında çalışılmaktadır (Shih, 1998). Pirinç kepeği, pirinç öğütme prosesinden büyük miktarlarda üretilen, besleyici değeri iyi ve protein etkinlik oranı yüksek olan, değeri düşük, kullanılmayan bir yan üründür. Yürütülen bilimsel çalışmalarda filmlerin oluşumunda kullanılan farklı pH’ların pirinç kepeği protein filmlerinin mekaniksel, çözünürlük ve bariyer özelliklerini etkilediği tespit edilmiştir. Pirinç kepeği filmlerinin delinme gücü pH 8’de artmakta ve daha sonra azalmaktadır. Pirinç kepeği filmlerinin sudaki en az çözünürlüğü pH 3’te görülmüştür (Adebiyi, 2006). pH 9.5’te ve pH 3.0’te oluşturulan pirinç kepeği protein filmlerinin su buharı geçirgenlikleri arasında fark yoktur. PVC filmiyle karşılaştırıldıklarında pirinç kepeği protein filmlerinin daha yüksek su buharı ve oksijen geçirgenliği gösterdikleri görülmüştür. pH 3.0’te hazırlanan pirinç kepeği protein filmleri PH 9.5’te hazırlananlardan daha düşük oksijen geçirgenliğine sahip olmuştur. pH 9.5’te hazırlanan pirinç kepeği protein filmine göre pH 3.0’te hazırlanan pirinç kepeği protein filminin delinme gücü, gerilme gücü, kopma faktörü ve protein çözünürlüğü daha yüksek bulunmuştur (Gnanasambandam vd., 1997).Pirinç proteinleri yüksek derecede hipoallerjenik ve çok iyi besleyici değere sahip olmasıyla eşsizdir. Son zamanlarda pirinç kepeği protein solüsyonlarından ve pirinç proteini ile pullulanın bir kombinasyonundan yapılan dispersiyonlardan oluşturulan, ardından kurutulan pirinç bazlı yenilebilir filmlerin hazırlanması ve karakterizasyonu konularında çalışılmaktadır (Shih, 1998). Pirinç kepeği, pirinç öğütme prosesinden büyük miktarlarda üretilen, besleyici değeri iyi ve protein etkinlik oranı yüksek olan, değeri düşük, kullanılmayan bir yan üründür. Yürütülen bilimsel çalışmalarda filmlerin oluşumunda kullanılan farklı pH’ların pirinç kepeği protein filmlerinin mekaniksel, çözünürlük ve bariyer özelliklerini etkilediği tespit edilmiştir. Pirinç kepeği filmlerinin delinme gücü pH 8’de artmakta ve daha sonra azalmaktadır. Pirinç kepeği filmlerinin sudaki en az çözünürlüğü pH 3’te görülmüştür (Adebiyi, 2006). pH 9.5’te ve pH 3.0’te oluşturulan pirinç kepeği protein filmlerinin su buharı geçirgenlikleri arasında fark yoktur. PVC filmiyle karşılaştırıldıklarında pirinç kepeği protein filmlerinin daha yüksek su buharı ve oksijen geçirgenliği gösterdikleri görülmüştür. pH 3.0’te hazırlanan pirinç kepeği protein filmleri PH 9.5’te hazırlananlardan daha düşük oksijen geçirgenliğine sahip olmuştur. pH 9.5’te hazırlanan pirinç kepeği protein filmine göre pH 3.0’te hazırlanan pirinç kepeği protein filminin delinme gücü, gerilme gücü, kopma faktörü ve protein çözünürlüğü daha yüksek bulunmuştur (Gnanasambandam vd., 1997).

Keratin filmi

Keratin memelilerin, sürüngenlerin ve kuşların saç, tüy, yapağı, tırnak ve boynuz gibi dış örtülerini oluşturan temel yapısal lifli proteindir. Yapağı keratinleri orta filament proteinleri ve matriks proteinleri olarak kabaca iki gruba ayrılan bir protein ailesidir. Tüylerde ise keratinin yumuşak ve sert olmak üzere iki tipi bulunmaktadır. Tüylerin yaklaşık % 90 olan yüksek protein içerikleri biyopolimerik filmlerin üretiminde potansiyel bir ilgi görmelerine neden olmaktadır.

Keratinin moleküler seviyede, en önemli ayırt edici özelliği sistein rezidülerinin yüksek konsantrasyonudur (toplam amino asit rezidülerinin % 7-20’si). Bu sistein rezidüleri yapağı ve tüy liflerinin mekaniksel, termal ve kimyasal özelliklerini belirleyen intermoleküler ve intramoleküler disülfit bağlarını oluşturmak için okside olmaktadır. Yüksek disülfid içerikli sert keratinler tüy, saç, tırnak ve toynak gibi epidermal apendajlarda bulunurken; az miktarda disülfid bağlarına sahip yumuşak keratinler epidermisin boynuzumsu dış tabakasında ve nasırda bulunmaktadır. Disülfid bağlarının miktarı büyük çoğunlukla keratinöz materyalin saç ve tüyler gibi sert, katı ve uzayamaz veya epidermis gibi yumuşak, esnek ve uzayabilir olup olamadığını belirlemektedir (Martelli vd., 2006; Vasconcelos vd., 2008).

Biyogeçirimli protein materyali olan yapağı keratininden filmler, mikrokapsüller ve süngerler hazırlanmaktadır. Keratin filmi kitosan filmiyle komposit halde de üretilmiş ve her iki filme göre mekaniksel gücün arttığı ve su buharı karakteristiğinin geliştiği görülmüştür (Tanabe vd., 2004). Kitosan keratin filmine dayanıklılık ve esneklik vermiştir. Keratin-kitosan komposit filminin de kitosan filmiyle aynı şekilde antibakteriyal aktiviteye sahip olduğu ve memeli hücreleri için iyi bir substrat olduğu görülmüştür (Tanabe vd., 2002).

Yapağıdan keratinin ekstraksiyonu çeşitli yöntemlerle olmakta, fakat bunların hepsi disülfit bağlarını serbest bırakan azaltıcı veya denatüre edici ajanların varlığını gerektirmektedir. Yapağıdan elde edilen keratin diğer uygulamalarda kullanılmadan önce hazır solventlerde çözünmektedir. Keratin birçok uygulamada yer almasına rağmen zayıf mekaniksel özellikler göstermektedir. Bu yüzden işlenebilirliğinin ve mekaniksel özelliklerinin geliştirilmesi için çapraz bağlama ajanlarının kullanılması ve yapısal lifli polimerlerle karıştırılması gerekmektedir. Bu amaçla keratin lifli polimerlerden olan deri fibroini ile karıştırılmış ve çözücü olarak formik asit kullanılmıştır. Bu uygulamada hem keratinin hem de fibroinin, kendilerini biyomedikal alanda tamamen değerli kılan seçkin özellikleriyle mükemmel biyopolimerler olduğu görülmüştür (Vasconcelos vd., 2008).

Keratin filmlerinin su buharı geçirgenliği, soya ve gluten gibi diğer proteinlerin filmlerinden daha düşük bulunmuştur (Martelli vd., 2006).

Eğer bir keratin filmi suda çözünmeyen bir plastikleştirici olmadan üretilirse çok kırılgan olmakta, filme plastikleştirici ilave edildiğinde ise filmin özellikleri gelişmekte, yüksek uzayabilirliğe sahip transparan filmler oluşmaktadır (Tanabe vd., 2004). Sorbitolle plastikleştirilen filmlerin su buharı geçirgenliği gliserolle plastikleştirilen filmlerden daha yüksek olmaktadır. Film çözünürlüğü sorbitol ilavesiyle büyük oranda artmaktadır. Nihai filmleri oluşturmada uygun uygulamaları belirlemek için bu sonuçlara başvurulabilir. Örneğin; yüksek su aktivitesine sahip materyallerin veya gıdaların ambalajları yüksek çözünürlüklü filmlere gerek duymadığından sorbitol ilave edilmemiş filmlerden yararlanılmalıdır (Martelli vd., 2006).

Farklı konsantrasyonlardaki gliserol tavuk tüyü keratin filmlerinin maksimum gerilme gücünü azaltmakta ve kopma sırasındaki uzama miktarını artırmaktadır. Bu nedenle gerilme gücü ve kopma sırasındaki uzama miktarı keratin dispersiyonuna eklenen gliserol konsantrasyonu sayesinde kontrol edilebilir. Düşük gliserol konsantrasyonu bu özellikleri belirgin şekilde değiştirmektedir. Keratin filmlerinin mikro yapısı film yüzeyini daha homojen yapan gliserol ilavesiyle değişmektedir. Termal analizler gliserol konsantrasyonundaki artışın filmlerin cam transisyonu sıcaklığını azalttığını göstermiştir. Keratin filmlerinin sudaki çözünürlüğü önceki literatürlerde bahsedilen diğer protein bazlı filmlere göre düşüktür. Gliserol ilavesi tavuk tüyü keratin filmlerinin hidrofilisitesini oldukça artırmıştır. Bu özellikten de filmin su buharına karşı gösterdiği bariyer özelliğini kontrol etmede yararlanılabilir. Gliserol ilavesiyle materyaldeki hidrofilisitede meydana gelen büyük artışın bütün su aktivitesi değerlerinde filmlerin su buharı geçirgenliğini kontrol ettiği kanıtlanmıştır. Bu artış filmlerdeki su difüzyonu katsayısının azalmasından daima daha yüksek olmaktadır (Moore vd., 2006). Yani keratin filmlerinin bariyer ve mekaniksel özelliklerini farklı plastikleştiriciler veya farklı plastikleştirici konsantrasyonları kullanarak arzu edilen şekilde geliştirmek mümkündür.

Kollajen filmi

Kollajen bağ dokunun temel yapı taşıdır ve hayvanların deri ve konnektif dokularında bol miktarda bulunmaktadır. Temel bağ dokunun ekstrasellüler proteinleri, tendon ve kemikteki % 90 veya daha fazla miktardaki kollajen ile derideki % 50’den daha fazla miktardaki kollajenden oluşmaktadır. Kollajen proteini tek hücreli hayvanlarda ve bitkilerde yoktur (Meena vd., 1999).

Kollajenin 19 farklı tipi vardır. Deri, tendon, kemik ve diğer dokuların ana bileşeni olan tip 1 kollajen oldukça güçlü ve dayanıklı liflerin içerisine yerleşmiş üçlü heliks yapısındaki zincir kurgusu şeklinde oluşmuştur. Kollajenin bu yapısı hidrojen bağları sayesinde korunmaktadır (Madhan vd., 2002). Makromoleküler liflerdeki kollajen molekülleri arasındaki kovalent intermoleküler bağları stabilite için oldukça önemlidir ve çeşitli fizikokimyasal özelliklerden sorumludur. Kollajenden yapılan biyomateryaller; biyolojik olarak uyumlu ve birçok dokuya karşı toksik olmamaları, iyi bilinen yapısal, fiziksel, kimyasal ve immünolojik özelliklere sahip olmaları, çeşitli şekillerde üretilebilmeleri ve büyük miktarlarda kolayca izole edilip saflaştırılabilmeleri gibi bazı avantajlara sahiptirler (Ho vd., 2001). Tip 2 kollajen kıkırdağın yapısında, tip 3 kollajen ise yetişkin deride tip 1 kollajen ile birleşmiş halde bulunur ve tip 1 kollajenin küçük bir miktarı bu kaynaktan sağlanmaktadır. Kollajenin diğer tipleri az miktarda oluşmakta ve özel biyolojik yapılarla birleşmektedirler (Meena vd., 1999).

Kollajen hem biyomedikal hem de endüstriyel uygulamalarda yaygın şekilde kullanılmaktadır. Estetik cerrahi, diş hekimliği, göz hekimliği, eczacılık, kozmetik ve biyoteknolojide yararlanılan önemli bir doğal biyolojik materyaldir. Endüstrideki kullanımı jelatin formunda ve çok büyük miktarda deri yapımındadır. Ayrıca, enzim üretiminde katı destekli mikro taşıyıcı olarak da kollajenden faydalanılmaktadır (Meena vd., 1999).

Kollajen filmi ise ticari olarak en yaygın şekilde kullanılan yenilebilir bir protein filmidir. Su buharı geçirgenliği çok iyi olmamasına karşın mükemmel bir oksijen geçirgenliğini engelleme özelliğine sahiptir. Kollagen kılıflar, sosis kaplamada büyük ölçüde doğal bağırsağın yerini almıştır. Kollagen kılıflar çok kalın tabakalar şeklinde üretilmedikleri sürece kaplama sosisle birlikte tüketilebilir, aksi takdirde tüketilmeden önce üründen uzaklaştırılmalıdır (Sarıoğlu, 2005).

Kollajen filmler sosis kaplamada doğal kaplamalara göre daha çok kullanılmaktadır. Bu filmlerin doğal kaplamalara göre birçok avantajı vardır:

1. Ürün işleme koşullarında sağlam kalab len, gerilme miktarı yüksek olan esnek bir yapıya sahiptirler,

2. Şeffaf ve sağlıklıdırlar,

3. Kapladıkları ürünün net ağırlığını arttırırlar (Sarıkuş, 2006).

Yumurta beyazı proteini filmi

Filmlerin ve kaplamaların geliştirilmesinde yumurta beyazı (albumin) ile diğer proteinler kadar çok çalışılmamıştır. Oysa ilgili patent hakkı bildiriminde albuminin gıdaların ve kozmetiklerin formülasyonunda kullanılan hidrofobik organik komponentler için enkapsülasyon aracı olarak kullanımı önerilmektedir. Nitekim yumurta albumini Durst (1969) tarafından geliştirilen koruyucu gıda kaplama formülasyonu olarak kullanılmaktadır. Okamoto (1978) ısıtılmış yumurta beyazı protein solüsyonunun yüzeyindeki film oluşumunun ısıtılmış soya sütünün yüzeyindeki soya proteini-lipid filmi oluşumuna benzediğini söylemiştir. Yumurta proteini, temel protein fraksiyonlarını oluşturan ovalbumin, konalbumin, ovomukoid, lizozim, globulin ve ovomukin ile yumurta beyazı katısının tek temel bileşenidir. Albumin sprey veya başka bir kurutma tekniği ile kurutulduktan sonra şekersizleştirilmiş (glukozun uzaklaştırılması) sıvı yumurta beyazından kuru toz formunda üretilmektedir. Yumurta albumini filmlerinin mekaniksel ve bariyer özellikleri eklenen plastikleştiricilerin tipi ve miktarına göre değişmektedir. Yumurta albumini filminin birçok özelliği diğer protein filmlerinin özelliklerine benzemesine rağmen buğday gluteni, soya protein izolatı ve mısır zeininden oluşturulan filmlere göre daha açık renkli ve daha transparan olmaktadır. Albumin filmleri oldukça hidrofilik olduğundan ticari kullanımdaki selüloz eteri bazlı suda çözünen paketlere benzeyen, gıda, kimya ve eczacılık endüstrilerindeki ingredientlerin konulduğu suda çözünen paketler (poşet) için kullanılabilir (Gennadios vd., 1996; Perez-Gago vd., 2005).

Yumurta beyazı proteinlerinden oluşan filmlerin gerilme özellikleri relatif nem (RH) ve gliserol içeriğine bağlı olarak değişmektedir. Filmlerin oksijen geçirgenlikleri düşük RH şartlarında az iken; RH yükseldiğinde fazlasıyla artmaktadır. Gliserol içeriği azaldığında daha iyi oksijen bariyerine sahip, fakat RH değişimine karşı daha hassas filmler oluşmuştur (Lim vd., 1998).

Süt proteini filmi

Süt ve süt ürünlerinin en önemli bileşenlerinden olan süt proteinleri, moleküler ve fizikokimyasal özellikleri birbirinden farklı, heterojen yapıdaki kazein, kesilmiş sütün suyu proteini ve peynir altı suyu proteinlerinden oluşmaktadır. Süt proteini bazlı filmler, gıdalarda tek başına kullanılabilecekleri gibi diğer kaplama materyalleri ile belirli oranlarda kombine edilerek de kullanılabilmektedirler. Süt proteini bazlı yenilebilir film ve kaplamaların fonksiyonel özelliklerini aşağıdaki gibi özetlemek mümkündür (Yılmaz vd., 2007):

• Kütle transferinin önlenmesi,

• Gıda maddesinin yapısal bütünlüğünün mekanik darbelere karşı korunması,

• İçine eklenen çesitli komponentlerle (flavor, renk, tat vb. maddeler) desteklenerek gıda maddesinin duyusal özelliklerini çekici hale getirmesi,

• Gaz transferinin (oksijen, karbondioksit) yavaşlatılması,

• Lipid kökenli kaplamalarla oluşturulan kompozit filmlerin depolama ve pişme sırasında nem transferini yavaşlatması,

• Gıda yüzeyine kaplanan antioksidant ve antimikrobiyaller gibi koruyucu katkı maddeleri için taşıyıcı yüzey olarak kullanılması,

• Flavor ve benzeri maddelerin mikrokapsülasyonunda da kullanılarak bu maddelerin gıdaya geçişlerini kolaylaştırması,

• Çeşitli bileşenlerden oluşmuş heterojen yapıdaki gıdalarda tabakaların ayrılmasında emülgatör olarak stabilite sağlaması,

• Esmerleşme reaksiyonlarını önleyici iyonlar, vitamin ve besleyici maddeler ilavesi ile gıdanın besleyici özelliğini arttırması.

Kesilmiş sütün suyu protein izolatlarından hazırlanan filmlerin elma ve patates dilimlerinde oksijen bariyeri olarak esmerleşmeyi azalttığı (Tien vd., 2001; Lee vd., 2003; Perez-Gago vd., 2005), bu protein izolatına antioksidant ilavesi ile hazırlanan kaplamaların yerfıstıklarını oksijen geçişinden ve oksidasyondan koruduğu (Han vd., 2008) ve yumurtaların raf ömrü için koruyucu bir bariyer olduğu (Caner, 2005) bildirilmektedir.

Süt proteinleri kalsiyum kazeinattan daha iyi bir antioksidant kapasitesine sahiptir. Bu farklılık iki protein tipinin de amino asit kompozisyonunun çeşitliliğinden kaynaklanmaktadır. Sütte bulunan laktozun antioksidatif aktiviteyi artırdığı düşünülmektedir. Aynı şekilde film formülasyonununa karboksimetilselüloz gibi polisakkaritlerin ilavesi antioksidatif gücü belirgin şekilde geliştirmiştir. Tatsız, kokusuz ve yenilebilir olan proteinler kesilmiş meyve ve sebzelerdeki enzimatik esmerleşmeyi dokulara zarar vermeden kontrol altında tutarlar. Ajanlarla etkinleştirilen süt proteinleri bazı işlenmiş gıdalardaki hidroperoksit oluşumunu ve lipid peroksidasyonunu önlemek için kullanılmaktadır (Tien vd., 2001).

Jelatin filmi

Endüstriyel olarak kemik ve derilerdeki kollajenden elde edilen çözünür jelatin, gıda ürünlerinin elastikliğini, kıvamını ve stabilitesini geliştirmek için katkı olarak yaygın şekilde kullanılmaktadır. Jelatinin ürünleri kuruma, ışık ve oksijenden korumak için dış bir film olarak da kullanılabileceği düşünülmüştür. Jelatin tekli kollajen zincirlerinin üçlü heliks yapısına kısmi dönüşümüyle soğukta tersinir bir jel oluşturma özelliğine sahiptir. Gıda kaynaklı jelatinin kalitesi, özellikle transparanlık, renk ve tadın varlığı ve kolay çözünme gibi karakteristikleri sınırlandıran reolojik özelliklerine (jel direnci ve viskozite gibi) bağlıdır. Tüm bu özellikler nedeniyle jelatin biyoaktif komponentler için matriks olarak kullanılan ilk materyallerden birisidir. Jelatin biyopolimerleri düşük fiyatlı ve mükemmel fonksiyonel özelliklere sahip oldukları için hala ilgi odağı olmaktadır (Gomez-Guillen vd., 2007).

Jelatin filmleri de diğer yenilebilir filmlerde olduğu gibi çeşitli plastikleştiricilerin farklı oranlarda ilavesiyle üretilmekte ve filmlerin karakteristik özellikleri plastikleştiricilerin cinsinden ve konsantrasyonundan etkilenmekte, bu etkilere göre şekillenmektedir. Yenilebilir filmlerin üretiminde tek tip plastikleştirici kullanımının neden olduğu plastikleştiricinin filmin dışında migrasyonu veya depolama sırasında kristalizasyonu gibi istenmeyen problemlerden sakınmak için farklı plastikleştiricilerin karışımı kullanılmaktadır. Jelatin filmleri gliserol ve sorbitol karışımıyla plastikleştirildiğinde su buharı geçirgenliği, mekaniksel ve viskoelastik özelliklerinin sadece gliserol veya sorbitol ile plastikleştirilen filmlere göre orta seviyede olduğu görülmüştür. Plastikleştirici konsantrasyonunun yükselmesi (25g/100g jelatin değerinden 55g/100g jelatin değerine) tahmin edildiği gibi fleksibilitede artışa, direnç ve su buharı bariyer özelliğinde azalmaya sebep olmaktadır. Karışımın etkisiyle ilişkili olarak, gliserol oranındaki artış gliserolün daha yüksek plastikleştirici etkisi nedeniyle delinme gücü, gerilme gücü, elastisite modülünde azalmaya ve delinme deformasyonu, kopma sırasındaki uzama ve su buharı geçirgenliğinde artışa neden olmaktadır. Bu sonuçlar filmlerdeki plastikleştirici moleküllerinin toplam sayısının fonksiyonu olan plastikleştiricilerin molekül ağırlığı ile ilişkilidir (Thomanize vd., 2005).

Dana derisi ve domuz derisinden yenilebilir jelatin filmleri üretildiğinde, kullanılan sorbitol delinme deformasyonunda olduğu kadar delinme gücünde de önemli bir plastikleştirici etkisi göstermiştir. Sorbitol içeriğiyle delinme gücü azalırken, delinme deformasyonu ve su buharı geçirgenliği artmaktadır (Sobral vd., 2001).

Jelatin gum arabik, aljinat ve pektat esterleri, çözünür ve hidroksi nişasta gibi diğer hidrokolloidlerle birlikte de kullanılır. Proteinpolisakkarit matriksinin plastikleştirilmesiyle oluştulan bu kompozit filmlerden birisi de kitosan-jelatin filmleridir. Bileşenlerin sıvı solüsyonlarından (pH<4.0) 60 ºC’de oluşturulup 22 ºC veya 66 ºC’de (sırasıyla düşük ve yüksek sıcaklık metodu) evapore edilerek hazırlanan kompozit filmler suyla veya poliollerle plastikleştirildiğinde toplam plastikleştirici içeriğinin artması (% 30 eklenirken) uzama yüzdesini arttırırken (orijinal değerine göre % 150’den fazla), elastisite modülünün ve gerilme gücünün oldukça azalmasına (orijinal değerine göre % 50’den fazla) neden olmuştur. Düşük sıcaklıkta hazırlama metodu kitosan-jelatin karışımındaki CO2 ve O2 geçirgenliği değerinin bir veya iki puan kadar azalmasına neden olan jelatinin yüzde renatürasyonunun daha çok gelişmesini sağlamıştır. Karışımın toplam plastikleştirici içeriğindeki artışın gaz geçirgenliğinde orantılı bir artışa neden olduğu bulunmuştur (Arvanitoyannis vd., 1998).

Sentetik polimerlerle karşılaştırıldığında protein filmlerinin zayıf su buharı direncine ve daha düşük mekaniksel güce sahip olmaları gıda ambalajındaki uygulamalarını sınırlandırmaktadır. Bu yüzden protein filmlerinin performansının geliştirilmesi için bazı çalışmalar yapılmıştır. Filmlerin su buharı bariyer özelliklerini geliştirmek için yaygın şekilde kullanılan yöntemlerden birisi film oluşturucu solüsyona lipidler gibi hidrofobik bileşenlerin katılmasıdır. Protein filminin fonksiyonelliğini geliştirmek için diğer bir alternatif; polimer zincirlerinin çapraz bağlanması aracılığıyla polimer ağının değiştirilmesidir. Proteinin amino asit zincirlerinin reaktif fonksiyonel gruplarının varlığı bu değişimi fiziksel, kimyasal ve enzimatik muamelelerle mümkün hale getirmektedir. Proteinin kovalent çapraz bağlanmasında kullanılan kimyasal ajanlar glutaraldehit, gliseraldehit, formaldehit, glioksal ve diğerleridir. Bu ajanların çoğu yenilemediğinden yenilebilir ambalaj için kullanımları bazı sınırlamalar gerektirmektedir. UV ve γ-ışınlaması gibi fiziksel çapraz bağlanma gıda endüstrisinde oldukça kabul edilir hale gelmiştir. Proteini çapraz bağlama yeteneği nedeniyle yeni ilgi uyandıran enzimlerden birisi de transglutaminazdır. Önceden sınırlı şekilde elde edilmesi ve yüksek fiyatı uygulanmasını sınırlandırırken, transglutaminaz günümüzde daha düşük fiyata sahip mikrobiyal bir kaynaktan elde edilmektedir (Chambi ve Grosso, 2006).

Yukarıda bahsedilen etkisi nedeniyle transglutaminaz jelatin filmlerinin geliştirilmesi için de kullanılmıştır. Transglutaminazla enzimatik olarak muamele edilen jelatin filmlerinin su buharı geçirgenlikleri daha azalmış, fakat modifiye filmlerin gerilme gücü değişmemiştir. Diğer taraftan transglutaminazın αs1-kazein filmlerinin mekaniksel özelliklerini artırdığı görülünce jelatin-kazein bazlı filmlerin üretimi için de kullanılabileceği düşünülmüştür. Transglutaminazla muamele edilen veya edilmeyen kazeinjelatin filmi sadece jelatinden veya sadece kazeinden elde edilen filmlerle karşılaştırıldığında önemli derecede daha yüksek uzama değeri göstermiştir. Kazein ve jelatin karışımı, en düşük su buharı geçirgenliğine sahip transglutaminazla muamele edilen kazein-jelatin formülasyonu (75:25) dışında gerilme gücü ve su buharı bariyer özelliklerini geliştirmezken sadece film uzamasında sinerjistik bir etki göstermiştir. Enzimatik çapraz bağlanma film oluşturucu solüsyondaki yüksek molekül ağırlıklı protein komponentindeki önemli miktardaki artışı da indüklemektedir (Chambi ve Grosso, 2006).

Jelatinle üretilmiş başka bir kompozit film de jellan-jelatin filmidir. Jellan Pseudomonas elodea’nın (son zamanlarda Sphingomonas paucimobilis olarak isimlendirilir) fermantasyonuyla üretilen ekstrasellülar bir polisakkarittir ve β-D-glukoz, β-D-glukoronik asit ve α-Lramnoz’un 2:1:1 molar oranlarda tetrasakkarit yenileme birimlerinden oluşmaktadır. Jellanın jelatine katılmasının jel ağ gücünde sinerjistik bir artışa ve jel sıkılığında bir gelişmeye neden olduğu belirtilmiştir. Jelatin yumuşak, fleksible ve elastik jel oluştururken, jellan sert ve parlak jeller oluşturmaktadır. Jellan/jelatin kompozit filmlerinin mekaniksel özellikleri jellanın jelatine göre oranına ve NaCl konsantrasyonuna bağlıdır. Jelatinin oranı arttığında gerilme gücü azalmakta ve gerilme uzaması artmaktadır. İki polimerin oranının değişmesi kompozit filmlerinin gücünü ve uzayabilirliğini değiştirmektedir. Tuz konsantrasyonu, jellan/jelatin oranına bağlı olan filmlerin mekaniksel özelliklerini de etkilemektedir. Sudaki çözünürlük ve kaynama oranı artan jelatin oranıyla azalmaktadır. Bu sonuçlardan farklı oranlardaki jellan/jelatin filmlerinin paketleme ve kaplama materyali olarak potansiyele sahip olduğu söylenebilir. Biyolojik olarak parçalanabilir olması nedeniyle bu filmler tüm uygulamalar için sentetik polimerlerin üzerinde bir avantaja sahiptir (Lee vd., 2004).

Bazı ülkelerde sıcak kanlı hayvanların jelatininin kullanılması deli dana hastalığının geçişi ve dini inançlar nedeniyle sınırlanmıştır. Bu yüzden balık endüstrisinin atıklarını avantaja dönüştüren balık jelatini üretimi son yıllarda önem kazanmıştır. Oldukça yeni olan, balık derisinden jelatin filmi üretimi ve karakterizasyonu çalışmalarında bütün balık jelatinlerinin mükemmel film oluşturucu özelliğe sahip oldukları görülmüştür. Sıcak su balığı olan Nile perch derisi jelatin filminin, kopma sırasındaki uzama ve sıkıştırma özellikleri açısından dana kemiği jelatiniyle aynı olduğu kaydedilmiştir. Gliserolle plastikleştirilen ton balığı derisi jelatin filmi domuz derisi jelatin filmiyle karşılaştırıldığında daha düşük su buharı geçirgenliği göstermiştir. Daha düşük su buharı geçirgenliği amino asit kompozisyonuyla açıklanabilir; bilindiği gibi balık jelatini hidrofobisitesi yüksek olan prolin (% 16) özellikle hidroksiprolin (% 18) açısından fakirdir (Carvalho vd., 2008).

Alaska pollack ve salmon jelatin filmleri, balıkların dondurulmuş derilerinden ekstrakte edilmiş ve memelilerden elde edilen farklı jelatin filmleriyle karşılaştırılmıştır. Soğuk su balıkları jelatin filmlerinin su buharı geçirgenliği sıcak su balıklarının ve memelilerin jelatin filmlerine göre daha azdır. Bu etki soğuk su balıklarında prolin ve hidroksiprolin miktarının daha az olmasından kaynaklanmaktadır. Yine jel gücü ve jel oluşum sıcaklığı soğuk su balıklarında daha düşüktür. Su buharı geçirgenliği düşük olan bu jelatin filmlerinin dondurulmuş gıdalardaki veya enkapsüle edilen ilaçlardaki su kaybını azaltmak için kullanılabileceği düşünülmektedir (Avena-Bustillos vd., 2006).

Atlantic halibut (H. hippoglossus) derisinden iki farklı tipte üretilen jelatinler uygun filmojenik kapasiteye sahip, transparan, açık renkli ve uzayabilirliği yüksek filmler oluşturmuştur (Carvalho vd., 2008).

Brownstripe red snapper (Lutjanus vitta) ve bigeye snapper (Priacanthus macracanthus) balık derisi jelatin filminden protein içeriği daha düşük olan kaynaklara göre daha ince, mekaniksel özellikleri daha iyi olan ve daha düşük su buharı geçirgenliğine sahip filmler hazırlanmıştır. Gliserolsüz filmler gliserolle hazırlanan filmlere göre çoğunlukla parlak ve daha fleksible olmuştur (Jongjareonrak vd., 2006).

Balık proteini filmi

Balık suda çözünen proteinlerinden üretilen yenilebilir filmler diğer birçok protein filmiyle karşılaştırıldığında daha az su buharı geçirgenliğine sahiptirler ve daha esnektirler (Iwata vd., 2000). Yürütülen çalışmalarda balık protein filmlerinin kalitesi ve özellikleri üzerine pH değişimi (Shiku vd., 2003), çeşitli fiziksel ve kimyasal muameleler (Weng vd., 2007, Benjakul vd., 2008) ve plastikleştirici özelliklerinin (Tanaka vd., 2001, Cuq vd., 1997, Garcia ve Sobral, 2005, Sobral vd., 2005, Bourtoom vd., 2006a, Weng vd., 2006, Cuq vd., 1998) etkili olduğu, ancak balık kalitesinin etkili olmadığı (Hamaguchi vd., 2007, Benjakul vd., 2008) görülmüştür.

Yenilebilir filmler direkt olarak balık etinden üretilebildikleri gibi surimi yıkama suyunda bulunan balık suda çözünür proteinlerinden de üretilebilmektedir (Shiku vd., 2004, Weng vd., 2006, Weng vd., 2007). Endüstriyel surimi üretim prosesinde tatsız ve kokusuz bir ürün üretmek için sarkoplazmik proteinleri uzaklaştırmak amacıyla balık kıyması soğutulmuş suyla birkaç kez yıkanır. Yıkama sonucunda balık kıymasının (öncelikle suda çözünen proteinleri içeren) yaklaşık 40-50 g/100 ml’si kaybedildiğinden surimi yıkama suyu besleyici ve oldukça fonksiyonel olan bazı suda çözünen proteinleri içerir. Surimi yıkama suyundaki bu proteinlerin kullanımı sadece olumsuz çevresel etkileri ve çöp atıklarının maliyetini azaltmaz, aynı zamanda özellikle suda çözünen proteinleri yenilebilir film şekline dönüştürerek de potansiyel fayda sağlamaktadır (Bourtoom vd., 2006b).

Diğer Protein Filmleri

Yukarıda behsedilen temel protein filmlerinin yanında farklı besinsel protein kaynaklarından da filmler üretilmiştir. Henüz üzerinde daha az çalışılmış bu protein filmleri mercimek proteini, turşu fermentasyon suyu proteini, domates proteini, elma proteini gibi farklı protein kaynaklarından oluşturulmuştur.

Karvakrol içeren domates yenilebilir filmleri zehirli patojen E. coli O157:H7’ yi inaktive etmekte ve inaktivasyon filmlerdeki karvakrol oranıyla ilgili olmaktadır. Antimikrobiyal denemelere göre optimum antimikrobiyal etki film hazırlanmadan önce karvakrolün domates püresine % 0.75 oranında eklenmesiyle elde edilmektedir (Du vd., 2007).

Orta derecede besleyici değeri olan mercimek proteini aynı zamanda yenilebilir film oluşumu için de iyi bir kaynaktır. Mercimek protein filmi güçlü, elastik ve iyi nem bariyer özelliğine sahiptir. Gerilme direnci diğer yenilebilir filmlerle karşılaştırıldığında selofandan daha iyidir. Mercimek protein filminin iyi delinme gücüne sahip olması onu uygun bir yapıştırıcı yapmaktadır. Su buharı geçirgenliği mısır ve buğday protein filmlerinden daha yüksektir. Mercimek protein konsantresi filminin diğer protein filmleriyle karşılaştırıldığında daha kırmızı ve sarı renkte olduğu görülmüştür. Filmin mekaniksel özelliklerinin, çözünürlüğünün ve su buharı geçirgenliğinin iyi olduğu belirtilmiştir (Bamdad vd., 2006).

Turşu fermentasyon suyundaki proteinlerden de yenilebilir filmler üretilmiş ve filmlerin özellikleri üzerine ısı muamelesi ve pH’nın etkisi incelendiğinde alkali pH ve sıcaklık filmin gerilme ve delinme gücünün azalmasına neden olmuştur. Filmlerin su buharı geçirgenlikleri pH’nın ve sıcaklığın artmasıyla azalmıştır. Sudaki filmlerin protein çözünürlüğü pH ve sıcaklığın artmasıyla artmıştır (Yıldırım ve Hettiarachchy, 1998).

Elma püresinden oluşturulan filmlere antimikrobiyal özellik kazandırmak için keklikotu, tarçın ve limon yaprağı yağı eklenmiş ve E. coli O157:H7’ye karşı keklikotu yağının en etkili olduğu, tarçın yağının ise en az etkili olduğu görülmüştür. Film oluşturucu solüsyona bu tip yağların eklenmesi su buharı geçirgenliğini azaltmış, oksijen geçirgenliğini artırmış, fakat filmlerin gerilme dirençlerini önemli derecede değiştirmemiştir (Rojas-Grau vd., 2006).

Elma püresinden oluşturulan filmlere yine antimikrobiyal etkisinden dolayı karvakrol katılmış ve optimum antimikrobiyal etkinin yaklaşık % 1 oranındaki karvakrol seviyesinde olduğu tespit edilmiştir. Film hazırlanmadan önce elma pürelerine karvakrol ilavesi elma filmlerinin su buharı ve oksijen geçirgenliğini azaltmıştır (Du vd., 2008).

Protein filmlerinin su ürünlerindeki uygulamaları

Kırmızı et, tavuk eti ve su ürünleri endüstrisinde yenilebilir kaplamaların kullanılması birçok potansiyel fayda sağlamaktadır. Şimdiye kadar yürütülen çalışmalarda gözlemlenen bu faydalar şunlardır:

• Taze veya donmuş etlerin depolanması sırasındaki nem kaybı ürünlerde tekstür, flavor ve renk değişikliklerine neden olmaktadır ve ürün miktarı da azalmaktadır. İyi nem bariyeri özellikleri ile yenilebilir kaplamalar nem kaybının önlenmesine yardım ederler. Örneğin; et vakum ambalajdan çıkarıldığı zaman nem evaporasyonu nedeniyle % 3-5 oranında bir ağırlık azalması meydana gelir. Oysa vakum ambalajlamadan önce kaplama uygulanması nem kaybını önlemektedir ve satılabilir ürün miktarını artırarak önemli bir ekonomik fayda yaratmaktadır.

• Taze kırmızı et, tavuk eti veya balık dilimleri plastik tepsilerde ambalajlandığında ürün suyunun sızması, paketi tüketicilere karşı itici hale getirmektedir. Yenilebilir kaplamalar suyu içerisinde tutulabilir, sızıntıları önler, ürünün sunumunu geliştirir ve bu sayede tepsinin dibine absorbent pedlerin yerleştirilmesine gerek kalmaz.

• Kırmızı etteki lipid oksidasyonunun neden olduğu ransidite oranı ve miyoglobin oksidasyonunun neden olduğu esmerleşme düşük oksijen geçirgenlikli yenilebilir kaplamaların kullanılmasıyla azaltılabilir.

• Uygulamadan önce ısıtılan yenilebilir kaplama solüsyonları bozulma yapıcı ve patojen mikroorganizma yükünü azaltabilir ve kaplanan kırmızı et, tavuk eti ve balık dilimlerinin yüzeyindeki zararlı proteolitik enzimleri kısmen inaktive eder.

• Kırmızı et, tavuk eti ve su ürünlerinden uçucu flavor kaybı ve yabancı kokuların gelişmesi yenilebilir kaplamalarla sınırlandırılabilir.

• Aktif ambalajlamanın bir uygulaması olan, antimikrobiyalleri veya antioksidantları taşıyan yenilebilir kaplamalar et yüzeyine direkt olarak uygulanabilir. Böylece ette ransidite oluşumu ile renk kaybı gecikir ve mikrobiyal yük azalır.

• Balık, tavuk eti ve kırmızı et parçalarının yüzeyine kaplama, paneleme ve kızartmadan önce uygulanan kaplamalar kızartma sırasındaki yağ alımını azaltarak ürünlerin besleyici değerini geliştirebilir (Gennadios vd., 1997).

Amerika’da 1980’lerin sonunda biftek, jambon, kılıflanmış rosto, kızartılmış biftek, balık filetoları ve kıymalarda kullanmak için ticari olarak yenilebilir bir kollagen filmi geliştirilmiştir. Üreticilere göre bu film pişirme ve büzülme kaybını azaltabilir, ürün suyunu artırabilir ve pişirme veya dumanlamadan sonra elastik streç kılıfın kolayca uzaklaştırılmasına izin verebilir ve jambonları ve sosisleri içeren pişirilmiş et ürünlerinin büyük çoğunluğunda sıvı serumları absorblamaktadır (Gennadios vd., 1997; Gennadios, 2002).

Soğuk dumanlanmış sardalyaların (Sardina pilchardus) raf ömrünü uzatmak için yüksek basınç (300 MPa/20ºC/15 dk) ve keklikotu ekstraktı veya biberiye ya da kitosan eklenerek zenginleştirilen jelatin bazlı fonksiyonel yenilebilir filmler tek başına ya da kombinasyon halinde uygulanmıştır. Kaplanmayan balıklar dumanlanma sırasında açığa çıkan fenoller sayesinde antioksidant güç göstermektedir. Keklikotu veya biberiye ekstraktıyla zenginleştirilen filmlerle kaplanan balıklar fenol içeriğini ve antioksidant gücünü artırmaktadır. Bitki ekstraktları eklenen yenilebilir filmler oksidasyon seviyesini ve mikrobiyal gelişmeyi azaltmıştır. Jelatin-kitosan filmi mikrobiyal gelişmeyi azaltmada en etkili olmuştur. Yüksek basınç ve yenilebilir film kombinasyonu hem oksidasyonu önleme hem de mikrobiyal gelişmeyi inhibe etme açısından en iyi sonucu göstermiştir (Gomez-Esteca vd., 2007).

Dondurulmuş somon filetoları üzerine asetillenmiş monogliseridler ve kazeinatla veya kesilmiş sütün suyu protein izolatıyla kombine kaplamaların uygulanması incelenmiştir. Kesilmiş sütün suyu protein izolatı kaplamanın tek başına kullanılmasının ardından bir antioksidantın (askorbik asit ve sitrik asit) spreylenmesi nem kaybı oranını etkilememiştir, fakat lipid oksidasyonunun başlangıcını geciktirmiş ve dondurulmuş King salmon örneklerindeki peroksit değerini azaltmıştır (Gennadios vd., 1997).

Kılınççeker ve arkadaşları (2009) tarafından yürütülen bir çalışmada yenilebilir materyallerle kaplanan alabalık filetolarının kalitesindeki değişiklikler belirlenmiştir. Kaplanan filetolar -18 ºC’ de 7 ay boyunca depolanmıştır. Kaplama materyalleri üç farklı aşamada (birinci, ikinci ve son kaplama) uygulanmış ve her aşamada farklı materyaller ve karışımlar kullanılmıştır. Kaplanan filetolar kızartılmış ve depolama periyodu boyunca yağ absorsiyonu ve nem içeriği analiz edilmiştir. Her ay kızartma işleminden önce duyusal özellikler ile fizikokimyasal ve biyokimyasal değişiklikler ölçülmüştür. Glutenin birinci, ksantan gumın ikinci ve buğday-mısır ununun 1:1 veya 2:1 oranında son kaplama olarak kullanılmasının en avantajlı uygulama olduğu gözlemlenmiştir. Kızartmadan önce yapılan analizlerde balık kalitesi hakkında fikir veren şu sonuçlar tespit edilmiştir; en düşük pH zein kaplanan örneklerde (6.25) ve guar kaplanan örneklerde (6.30) bulunmuştur. En düşük TBA seviyesi kazeinle kaplanan filetolarda 2.07 mg, ksantan gumla kaplanan filetolarda 2.44 mg ve buğdaymısır unu karışımının 2:1 oranında 2.25 mg olarak belirlenmiştir. En düşük TVB-N seviyesi kazein karışımıyla kaplanan filetolarda 18.06 mg/100 g, ksantan gumla kaplanan filetolarda 18.62 mg/100g ve buğday-mısır unu karışımının 1:1 oranıyla kaplanan filetolarda 18.47 mg/100g olarak bulunmuştur. Duyusal analizlerde kaplanan örnekler kaplanmayan örneklerden daha çok tercih edilmiştir. Bahsedilen materyallerin etkisi sonucunda et yüzeyindeki kaplama tabakası depolama sırasındaki kütle transferine karşı daha dirençli olmayı sağlamıştır.

Lizozimle birleştirilen peynir altı suyundan elde edilen filmlerin ve kaplamaların mikrobiyal media ve soğuk dumanlanmış somonlardaki Listeria monocytogenes’in inhibisyonu üzerindeki etkisi incelenmiştir. Model gıda olarak kullanılan dumanlanmış somonlardaki inhibisyon etkisi başlangıçta, 4 °C ve 10 °C’de 35 günlük depolama boyunca izlenmiştir. Lizozim içeren ve içermeyen bu filmlerin gerilme özellikleri (elastik katsayısı, gerilme gücü ve uzama yüzdesi), oksijen geçirgen likleri ve renkleri karşılaştırılmıştır. Lizozim, broth ve agar mediadaki Listeria monocytogenes’i inhibe etmiştir. Filmin her bir gramı için 204 mg ilave edilen lizozim 4.4 log CFU/cm2 Listeria monocytogenes içeren bir preparatın gelişmesini baskılamıştır. Kaplama solüsyonunun her bir gramı için 25 mg kullanılan lizozim başlangıçta dumanlanmış somon örneklerindeki Listeria monocytogenes’i 2.4 log CFU/g, total aerobları 4.5 log CFU/g ve mayalarla küfleri 3.0 log CFU/g’dan daha fazla inaktif etmiştir. Lizozim içeren kaplama hem 4°C hem de 10°C’de Listeria monocytogenes’in gelişimini geciktirmiştir (Min vd., 2005).

Gıdanın içine çözelti difüzyonunu azaltmak için yüzey filmleri kullanılabilmektedir. Örneğin, yüzeyinde yüksek oranda sorbik asit bulunan bir gıda maddesi protein bir filmle kaplanarak, sorbik asit muhafaza edilmekte ve mikrobiyal gelişme yavaşlatılmaktadır. Benzer bir uygulama da, karides ve yengecin tuzlu su içinde dondurulması sırasında gıda içine tuz difüzyonunu azaltmak amacıyla kullanılmasıdır. Yenilebilir kaplamalar kullanılarak, ürünün bazı durumlarda yapısal olarak daha dayanıklı hale getirilmesi de sağlanabilmektedir. Bunun sonucunda işleme, depolama ve dağıtım süresince ısıya karşı daha dayanıklı ürünler elde edilebilmektedir (Sarıoğlu, 2005).

Arrowtooth flounder (Atherestes stomias) Alaska körfezinde en çok bulunan ve az kullanılan balık kaynağıdır. Bu balık türü kendine özgü bir nedenle; yapısındaki proteinleri parçalayarak kıyma lapasına döndüren endojen proteolitik enzimlerin varlığıyla, büyük miktarda protein sağlamaktadır. Bu nedenle bazı araştırmacılar az kullanılan Arrowtooth flounder (AF) balığından balık protein tozları üretmiş ve bunu yenilebilir film ve kaplama olarak farklı gıda ürünlerinde kullanmışlardır (Ambardekar, 2007). AF filmleri ve yumurta albumini, kitosan, somon proteini ve soya proteini gibi farklı kaplamalar 3 ay boyunca dondurularak depolanan Pink salmon filetoları üzerine uygulanmıştır. En iyi etkiyi kitosan gösterirken Pink salmon filetolarının relatif nem kaybı ve lipid oksidasyonu açısından AF filmiyle ve diğer filmlerle kaplama arasında fark bulunmamıştır. AF kaplama, kaplanmayan filetolarla karşılaştırıldığında nem kaybını azaltmış, lipid oksidasyonunu minimize etmiş ve verimliliği artırmıştır. Yenilebilir filmle kaplanan balıkların rengi ve tekstür özellikleri kaplanmayan filetolardan daha iyi olmuştur. Balıklardaki kaplama verimini, çözünme verimini, pişirme verimini artırdığı ve çözünme kayıplarını azalttığı için AF proteinlerinin su ürünlerinde görünmez bir koruyucu olarak kullanım potansiyeline sahip olacağı düşünülmektedir (Sathivel, 2005).

Sonuç

Yapılan literatür çalışmalarının ışığında su ürünlerinin muhafazası amacıyla yenilebilir protein filmlerinden faydalanılabileceği görülmüştür. Bitkisel ve hayvansal kaynaklardaki farklı proteinlerden olduğu gibi, su ürünleri etindeki yapısal proteinlerden veya su ürünleri işleme proseslerinden açığa çıkan atıklardaki suda çözünen proteinlerden oluşturulan filmlerin de başarılı bir şekilde kullanılabileceği düşünülmektedir. Bu sayede hem işleme atıkları değerlendirilecek hem de plastik bazlı ambalajların neden olduğu atık sorunu ve kanserojen riski oldukça azalacaktır. Su ürünlerinin doğal yapısı yine doğal kaynaklardan elde edilen yenilebilir filmler sayesinde korunacak ve daha güvenli ürünlerin geliştirilmesi mümkün olacaktır.

References

Adebiyi, A. P., Adebiyi, A. O., Jin, D.H., Ogawa, T., Muramoto, K., (2008). Rice bran proteinbased edible films, International Journal of Food Science and Technology, 43: 476-483.doi:10.1111/j.1365-2621.2006.01475.x.

Akbaba, G., (2006). Yenilebilirambalajlar, BilimveTeknikDergisi, 30-32.

Ambardekar, A., (2007). Potential use of Arrowtooth flounder (AtherestesStomias) protein as edible coating in food industry, Asian Fisheries Science, 20(4): 383-393.

Appendini, P., Hotchkiss, J. H., (2002). Review of antimicrobial food packaging, Innovative Food Science and Emerging Technologies, 3: 113–126. doi: 10.1016/S1466- 8564(02)00012-7.

Arvanitoyannis, I. S., Nakayama, A., Aiba S., (1998). Chitosan and gelatin based edible films: state diagrams, mechanical and permeation properties, Carbohydrate Polymers, 37: 371-382. doi: 10.1016/S0144- 8617(98)00083-6.

Avena-Bustillos, R. J., Olsen, C. W., Olson, D. A., Chiou, B., Yee, E., Bechtel, P. J., McHugh, T. H., (2006). Water vapor permeability of mammalian and fish gelatinfilms, Journal of Food Science, 71(4): E202- E207. doi: 10.1111/j.1750- 3841.2006.00016.x.

Aydinli, M., Tutas, M., (2000). Water sorption and water vapour permeability properties of polysaccharide (locust bean gum) based edible films, LebensmittelWissenschaft und Technologie, 33: 63-67. doi: /10.1006/fstl.1999.0617.

Ayhllon-Meixueiro, F., Vaca-Garcia, C., Silvestre, F., (2008). Biodegradable films from isolate of sunflower (Helianthus annuus) proteins, Journal of Agricultural and Food Chemistry, 48(7): 3032-3036. doi: 10.1021/jf9907485.

Bamdad, F., Goli, A. H., Kadivar, M., (2006). Preparation and characterization of proteinous film from lentil (Lens culinaris) edible film from lentil (Lens culinaris), Food Research International, 39: 106-111. doi:10.1016/j.foodres.2005.06.006.

Benjakul, S., Artharn, A., Prodpran, T., (2008). Properties of protein-based film from Round scad (Decapterusmaruadsi) muscle as influenced by fish quality, LebensmittelWissenschaft und Technologie, 41: 753-763. doi:10.1016/j.lwt.2007.05.015.

Bostan, K., Aldemir, T., Aydin, A., (2007). Kitosanveantimikrobiyalaktivitesi, TürkMikrobiyolojiCemiyetiDergisi, 37(2): 118- 127.

Bourtoom, T., Chinnan, M. S., Jantawat, P., Sanguanddekul, R., (2006a). Effect of plasticizer type and concentration on the properties of edible film from water-soluble fish proteins in surimi wash-water, Food Science and Technology Iternational, 12: 119-126. doi: 10.1177/1082013206063980.

Bourtoom, T., Chinnan, M. S., Jantawat, P., Sanguanddekul, R., (2006b). Effect of select parameters on the properties of edible film from water-soluble fish proteins in surimi wash-water, LebensmittelWissenschaft und Technologie, 39: 405-418. doi: 10.1016/j.lwt.2005.02.020.

Callegarin, F., Gallo, J. A. Q., Debeaufort, F., Voilley, A., (1997). Lipids and biopackaging, Journal of the American Oil Chemists’ Society, 74: 1183-1192. doi: 10.1007/s11746-997-0044-x.

Caner, C., (2005). Whey protein isolate coating and concentration effects on egg shelf life, Journal of the Science of Food and Agriculture, 85: 2143-2148. doi: 10.1002/jsfa.2225.

Carvalho, R. A., Sobral, P. J. A., Thomazine, M., Habitante, A. M. Q. B., Gimenez, B., Gomez-Guillen, M. C., Montero, P., (2008). Development of edible films based on differently processed Atlantic halibut (Hippoglossushippoglossus) skin gelatin, Food Hydrocolloids, 22: 1117-1123. doi: 10.1016/j.foodhyd.2007.06.003.

Chambi, H., Grosso, C., (2006). Edible films produced with gelatin and casein crosslinked with transglutaminase, Food Research International, 39: 458-466.doi:10.1016/j.foodres.2005.09.009.

Crackel, R.L., Gray, J.F., Booren, A.M., Pearson, A.M., Buckley, D.J., (1988). Effect of antioxidants on lipid stability in restuctured beef steaks, Journal of Food Science, 53(2): 655-657. doi: 10.1111/j.1365- 2621.1988.tb07780.x.

Cuq, B., Gontard, N., Cuq, J. L., Guilbert, S., (1997). Selected functional properties of fish myofibrillar protein-based films as affected by hydrophilic plasticizers, Journal of Agricultural and Food Chemistry, 45: 622- 626. doi: 10.1021/jf960352i.

Cuq, B., Gontard, N., Cuq, J. L., Guilbert, S., (1998). Packaging films based on myofibrillar proteins: fabrication, properties and applications, Nahrung, 42(3/4): 260- 263. doi: 0027-769X/98/0304- 0260$17.50+.50/0.

Cuq, B., Gontard, N., Guilbert, S., (1995). Edible films and coatings as active layers, in Rooney, eds, Active food packaging, 111- 142, Chapman & Hall, London,UK.

Datta, S., Janes, M. E., Xue, Q. G., Losso, J., La Peyre, J. F., (2008). Control of Listeria monocytogenes and Salmonella anatum on the surface of smoked salmon coated with calcium alginate coating containing oyster lysozyme and nisin, Journal of Food Science, 73(2): M67-M71. doi: 10.1111/j.1750-3841.2007.00633.x .

Debeaufort, F., Quezada-Gallo, J. A., Voilley, A., 1998. Edible films and coatings: tomorrow's packagings: a review, Critical Reviews in Food Science, 38(4): 299-313. doi: 10.1080/10408699891274219.

Di Pierro, P., Chico, B., Villalonga, R., Mariniello, L., Masi, P., Porta, R., (2007). Transglutaminase-catalyzed preparation of chitosan–ovalbumin films, Enzyme and Microbial Technology, 40: 437-441. doi: 10.1016/j.enzmictec.2006.07.017.

Du, W. X., Olsen, C. W., Avena-Bustillos, R. J., McHugh, T. H., Levin C. E., Friedman, M., (2007). Antibacterial activity against E. coli 0157:H7, physical properties and storage stability of novel carvacrol-containing edible tomato films, Jouurnal of Food Science, 73(7): E378-E383. doi: 10.1111/j.1750- 3841.2008.00892.x.

Du, W. X., Olsen, C. W., Avena-Bustillos, R. J., McHugh, T. H., Levin C. E., Friedman, M., (2008). Storage stability and antibacterial activity against Escherichia coli O157:H7 of carvacrol in edible apple films made by two different casting methods, Journal of Agricultural and Food Chemistry, 56: 3082- 3088. doi: 10.1021/jf703629s.

Duman, S. S., Senel, S., (2004). Kitosanveveterineralandakiuygulamalari, VeterinerCerrahiDergisi, 10(3-4): 62-72.

Erickson, M. C., Hung, Y., (1997). Quality in frozen food, Springer, 484 s.

Garcia, F. T., Sobral, P. J. A., (2005). Effect of the thermal treatment of the filmogenic solution on the mechanical properties, color and opacity of films based on muscle proteins of two varieties of Tilapia, LebensmittelWissenschaft und Technologie, 38: 289-296.doi:10.1016/j.lwt.2004.06.002.

Garcia, M. A., Martino, M. N., Zaritzky, N. E., (2000). Lipid addition to improve barrier properties of edible starch-based films and coatings, Journal of Food Science, 65(6): 941-947. doi: 10.1111/j.1365- 2621.2000.tb09397.x.

Gennadios, A., (2002). Protein based films and coatings, CRC Press LLC, 672 p.

Gennadios, A., Hana, M. A., Kurth, L. B., (1997). Application of edible coatings on meats, poultry and seafoods: a review, LebensmittelWissenschaft und Technologie, 30: 337-350. doi: 10.1006/fstl.1996.0202.

Gennadios, A., Weller, C. L., Hana, M. A., Froning, G. W., (1996). Mechanical and barrier properties of egg albumen films, Journal of Food Science, 61(3): 585-589. doi: 10.1111/j.1365-2621.1996.tb13164.x.

Gnanasambandam, R., Hettiarachchy, N. S., Coleman, M., (1997). Mechanical and barrier properties of rice bran films, Journal of Food Science, 62(2): 395-398. doi: 10.1111/j.1365-2621.1997.tb04009.x.

Gombotz, W. R., Wee, S. F., (1998). Protein release from alginate matrices, Advanced Drug Delivery Reviews, 31: 267-285. doi: 10.1016/S0169-409X(97)00124-5.

Gomez-Esteca, J., Montero, P., Gimenez, B., Gomez-Guillen, M. C., (2007). Effect of functional edible films and high pressure processing on microbial and oxidative spoilage in cold-smoked Sardine (Sardinapilchardus), Food Chemistry, 105: 511–520. doi:10.1016/j.foodchem.2007.04.006.

Gomez-Guillen, M. C., Ihl, M., Bifani, V., Silva, A., Montero, P., (2007). Edible films made from tuna-fish gelatin with antioxidant extracts of two different murta ecotypes leaves (UgnimolinaeTurcz), Food Hydrocolloids, 21: 1133-1143. doi:10.1016/j.foodhyd.2006.08.006. Grevellec, J., Marquie, C., Ferry, L., Crespy, A., Vialettes, V., (2001). Processability of cottonseed proteins into biodegradable materials, Biomacromolecules, 2: 1104- 1109. doi: 10.1021/bm015525d.

Hamaguchi, P. Y., Weng, W., Kobayashi, T., Runglertkreingkrai, J., Tanaka, M., (2007). Effect of fish meat quality on the properties of biodegradable protein films, Food Science and Technology Research, 13(3): 200-204. doi:10.3136/fstr.13.200.

Han, J. H., Hwang, M., Min, S., Krochta, J.M., (2008). Coating of peanuts with edible whey protein film containing a-tocopherol and ascorbylpalmitate, Journal of Food Science, 73(8): 349-355. doi: 10.1111/j.1750- 3841.2008.00910.x.

Ho, H. O., Lin, C. W., Sheu, M. T., (2001). Diffusion characteristics of collagen film, Journal of Controlled Release, 77: 97-105. doi: 10.1016/S0168-3659(01)00467-9.

Iwata, K., Ishizaka, S., Handa, A., Tanaka, M., (2000). Preparation and characterization of edible films from fish water-soluble proteins, Fisheries Science, 66: 372-378. doi: 10.1046/j.1444-2906.2000.00057.x.

Jangchud A., Chinnan M. S., (1999a). Peanut protein film as affected by drying temperature and pH of film forming solution, Journal of Food Science, 64(1): 153-157. doi:10.1111/j.1365- 2621.1999.tb09881.x.

Jangchud, A., Chinnan, M. S., (1999b). Properties of peanut protein film: sorption isotherm and plasticizer effect, LebensmittelWissenschaft und Technologie, 32: 89-94. doi: 10.1006/fstl.1998.0498.

Jongjareonrak, A., Benjakul, S., Visessanguan, W., Prodpran, T., Tanaka, M., (2007). Characterization of edible films from skin gelatin of brownstripe Red snapper and Bigeye snapper, Food Hydrocolloids, 20: 492-501. doi: 10.1016/j.foodhyd.2005.04.007.

Kandemir, N. S., (2006). Dogalantimikrobiyalmaddeiçerenyenilebilirpullulan film uygulamaninhazirsalataninrafömrüneetkileri, Yükseklisanstezi, EgeÜniversitesi Fen BilimleriEnstitüsü, Izmir.

Kayserilioglu, B.S., Bakir, U., Yilmaz, L., Akkas, N., (2003). Drying temperature and relative humidity effects on wheat gluten film properties, Journal of Agricultural and Food Chemistry, 51: 964-968. doi: 10.1021/jf0205817.

Kester, J. J., Fennema, O., (1989). Resistance of lipid films to oxygen transmission, Journal of the American Oil Chemists’ Society, 66(8): 1129-1138. doi: 10.1007/BF02670099.

Kilinççeker, O., Dogan, I. S., Küçüköner, E., (2009). Effect of edible coatings on the quality of frozen fish fillets, LWT - Food Science and Technology, 42: 868-873. doi: 10.1016/j.lwt.2008.11.003.

Kim, K. W., Thomas, R. W., (2007). Antioxidative activity of chitosans with varying molecular weights, FoodChemistry, 101: 308-313. doi: 10.1016/j.foodchem.2006.01.038.

Krochta, J.M., De Mulder-Johston, C., (1997). Edible and biodegradable polymer films: challenges and opportunities, Food Technology, 51(2): 61-74.

Lee, J. Y., Parkab, H. J., Lee, C. Y., Choi, W. Y., (2003). Extending shelf-life of minimally processed apples with edible coatings and antibrowning agents, LebensmittelWissenschaft und Technologie, 36: 323-329. doi: 10.1016/S0023-6438(03)00014-8.

Lee, K. Y., Shim, J., Lee, H. G., (2004). Mechanical properties of gellan and gelatin composite films, Carbohydrate Polymers, 56: 251-254. doi: 10.1016/j.carbpol.2003.04.001.

Lim, L. T., Mine, Y., Tung M. A., (1998). Transglutaminase cross-linked egg white protein films: tensile properties and oxygen permeability, Journal of Agricultural and Food Chemistry, 46(10): 4022-4029. doi: 10.1021/jf980567n.

Liu, C. C., Tellez-Garay, A. M., Castell-Perez, M. E., (2004). Physical and mechanical properties of peanut protein films, LebensmittelWissenschaft und Technologie, 37: 731-738. doi: 10.1016/j.lwt.2004.02.012.

Lo’pez-Caballero, M. E., Gomez-Guillen, M. C., Perez-Mateos M., Montero, P., (2005). A chitosan–gelatin blend as a coating for fish patties, Food Hydrocolloids, 19: 303–311. doi:10.1016/j.foodhyd.2004.06.006.

Madhan, B., Muralidharan, C., Jayakumar, R., (2002). Study on the stabilisation of collagen with vegetable tannins in the presence of acrylic polymer, Biomaterials, 23: 2841- 2847. doi: 10.1016/S0142-9612(01)00410-0.

Mariniello, L., Pierro, P., Esposito, C., Sorrentino, A., Masi, P., Porta, R., (2003). Preparation and mechanical properties of edible pectin-soy flour films obtained in the absence or presence of transglutaminase, Journal of Biotechnology, 102: 191-198. doi: 10.1016/S0168-1656(03)00025-7.

Marquie, C., Aymard, C., Cuq, J. L., Guilbert, S., (1995). Biodegradable packaging made from cottonseed flour: formation and improvement by chemical treatments with gossypol, formaldehyde, and glutaraldehyde, Journal of Agricultural and Food Chemistry, 43: 2762-2767. doi: 10.1021/jf00058a040.

Martelli, S. M., Moore, G. R. P., Laurindo, J. B., (2006). Mechanical properties, water vapor permeability and water affinity of feather keratin films plasticized with sorbitol, Journal of Polymers and the Environment, 14: 215-222. doi: 10.1007/s10924-006- 0017-4.

McHugh, T. H., (2000). Protein-lipid interactions in edible films and coatings, Nahrung, 44(3): 148-151. doi: 10.1002/1521- 3803(20000501)44:3<148::AIDFOOD148> 3.0.CO;2-P .

Meena, C., Mengi, S. A., Deshpande, S. G., (1999). Biomedical and industrial applications of collagen, Procceedings of the Indian Academy of Sciences (Chemical Sciences), 111(2): 319-329. doi: 10.1007/BF02871912.

Min, S., Haris, L. J., Krochta, J. M., (2005). Listeria monocytogenes inhibition by whey protein films and coatings incorporating lysozyme, Journal of Food Protection, 68(11): 2317-2325.

Moore, G. R. P., Martelli, S. M., Gandolfo, C., Sobral, P. J. A., Laurindo, J. B., (2006). Influence of the glycerol concentration on some physical properties of feather keratin films, Food Hydrocolloids, 20: 975-982. doi: 10.1016/j.lwt.2004.12.014.

Orliac, O., Silvestre, F., (2003). New thermomolded biodegradable films based on sunflower protein isolate: aging and physical properties, Macromoecular Symposia, 197: 193-206. doi: 10.1002/masy.200350718.

Peressini, D., Bravin, B., Lapasin, R., Rizzotti, C., Sensidoni, A., (2003). Starch– methylcellulose based edible films: rheological properties of film-forming dispersions, Journal of Food Engineering, 59: 25-32. doi: 10.1016/S0260- 8774(02)00426-0.

Perez-Gago, M. B., Serra, M., Rio, M. A., (2006). Color change of fresh-cut apples coated with whey protein concentrate-based edible coatings, Postharvest Biology and Technology, 39: 84-92. doi: 10.1016/j.postharvbio.2005.08.002.

Rayas, L. M., Hernandez, R. J., Ng, P. K. W., (1997). Development and characterization of biodegradable/edible wheat protein films, Journal of Food Science, 62(1): 160-162. doi: 10.1111/j.1365-2621.1997.tb04390.x.

Rhim, J. W., Ng P. K. W., (2007). Natural biopolymer-based nanocomposite films for packaging applications, Critical Reviews inFood Science and Nutrition, 47(4): 411-433. doi: 10.1080/10408390600846366.

Rojas-Grau, M. A., Avena-Bustillos, R. J., Friedman, M., Henika, P. R., Martian- Belloso, O., McHugh, T. H., (2006). Mechanical, barrier, and antimicrobial properties of apple puree edible films containing plant essential oils, Journal of Agricultural and Food Chemistry, 54: 9262- 9267. doi: 10.1021/jf061717u.

Sabato, S. F., Nakamurakare, N., Sobral, P. J. A., (2007). Mechanical and thermal properties of irradiated films based on Tilapia (Oreochromisniloticus) proteins, Radiation Physics and Chemistry, 76: 1862-1865. doi: 10.1016/j.radphyschem.2007.02.096.

Sarikus, G., (2006). Farkliantimikrobiyalmaddeleriçerenyenilebilir film üretimivekasarpeynirininmuhafazasindamikrobiyalinaktivasyonaetkisi, Yükseklisanstezi, SüleymanDemirelÜniversitesi Fen BilimleriEnstitüsü, Isparta.

Sarioglu, T., (2005). Yenilebilirfilmlerinkasarpeynirininkaplanmasindakullanilmaolanaklarivepeynirkalitesiüzerineetkileri, Yükseklisanstezi, SüleymanDemirelÜniversitesi Fen BilimleriEnstitüsü, Isparta.

Sathivel, S., (2005). Chitosan and protein coatings affect yield, moisture loss, and lipid oxidation of Pink Salmon (Oncorhynchusgorbuscha) fillets during frozen storage, Journal of Food Science, 70(8): 455-459. doi: 10.1111/j.1365-2621.2005.tb11514.x.

Shahidi, F., Kamil, J., Jeon, Y. J., Kim, S. K., (2002). Antioxidant role of chitosan in cooked Cod (Godusmorhua) model system, Journal of Food Lipids, 9(1): 57-64. doi: 10.1111/j.1745-4522.2002.tb00208.x.

Shih, F. F., (1998). Film-forming properties and edible films of plant proteins, Nahrung, 42(3/4): 254-256. doi: 0027-769X/98/0304- 0254$17.50+.50/0.

Shiku, Y., Hamaguchi, P. Y., Benjakul, S., Visessanguan, W., Tanaka, M., (2004). Effect of surimi quality on properties of edible films based on Alaska pollack, Food Chemistry, 86: 493-499. doi: 10.1016/j.foodchem.2003.09.022.

Shiku, Y., Hamaguchi, P. Y., Tanaka M., (2003). Effect of pH on the preparation of edible films based on fish myofibrillar proteins, Fisheries Science, 69: 1026-1032. doi: 10.1046/j.1444-2906.2003.00722.x.

Sobral, P. J. A., Menegalli, F. C., Hubinger, M. D., Roques, M. A., (2001). Mechanical, water vapor barrier and thermal properties of gelatin based edible films, Food Hydrocolloids, 15: 423-432. doi: 10.1016/S0268-005X(01)00061-3.

Sobral, P. J. A., Santos, J. S., Garcia, F. T., (2005). Effect of protein and plasticizer concentrations in film forming solutions on physical properties of edible films based on muscle proteins of a Thai Tilapia, Journal of Food Engineering, 70: 93-100. doi: 10.1016/j.jfoodeng.2004.09.015.

Tanabe, T., Okitsu, N, Tachibana, A., Yamauchi, K., (2002). Preparation and characterization of keratin–chitosan composite film, Biomaterials, 23: 817-825. doi: 10.1016/S0142-9612(01)00187-9.

Tanabe, T., Okitsu, N., Yamauchi, K., (2004). Fabrication and characterization of chemically crosslinked keratin films, Materials Science and Engineering, 24: 441- 446. doi: 10.1016/j.msec.2003.11.004.

Tanaka, M., Iwata, K., Sanguandeekul, R., Handa, A., Ishizaki, S., (2001). Influence of plasticizers on the properties of edible films prepared from fish water-soluble proteins, Fisheries Science, 67: 346-351. 10.1046/j.1444-2906.2001.00237.x.

Temiz, H., Yesilsu, A. F., (2006). Bitkisel protein kaynakliyenilebilir film vekaplamalar, GidaTeknolojisiDergisi, 2: 41-50.

Thomanize, M., Carvalho, R. A., Sobral, P. J. A., (2005). Physical properties of gelatin films plasticized by blends of glycerol and sorbitol, Journal of Food Science, 70(3): E172-E176. doi: 10.1111/j.1365- 2621.2005.tb07132.x.

Tien, C. L., Vachon, C., Mateescu, M. A., Lacroix, M., (2001). Milk protein coatings prevent oxidative browning of apples and potatoes, Journal of Food Science, 66(4): 512-516. doi: 10.1111/j.1365- 2621.2001.tb04594.x.

Tsai, G. J., Su, W. H., Chen, H. C., Pan, C. L., (2002). Antimicrobial activity of shrimp chitin and chitosan from different treatments and applications of fish preservation, Fisheries Science, 68: 170-177. doi: 10.1046/j.1444-2906.2002.00404.x.

Turhan K. N., Sahbaz, F., (2004). Water vapor permeability, tensile properties and solubility of methylcellulose-based edible films, Journal of Food Engineering, 61: 459-466. doi: 10.1016/S0260- 8774(03)00155-9.

Vasconcelos, A., Freddi, G., Cavaco-Paulo, A., (2008). Biodegradable materials based on silk fibroin and keratin, Biomacromolecules, 9(4): 1299-1305. doi: 10.1021/bm7012789.

Viroben, G., Barbot, J., Mouloungui, Z., Gue’guen, J., (2000). Preparation and characterization of films from pea protein, Journal of Agricultural and Food Chemistry, 48: 1064-1069. doi: 10.1021/jf9813891.

Weng, W., Hamaguchi, P. Y., Osako, K., Tanaka, M., (2007). Properties of edible surimi film as affected by heat treatment of filmforming solution, Food Science and Technology Research, 13(4): 391- 398. doi:10.3136/fstr.13.391.

Weng, W., Hamaguchi, P. Y., Tanaka, M., (2006). Effect of propylene glycol alginate on the properties of edible film prepared from Alaska pollacksurimi, Journal of the Japanese Society for Food Science and Technology, 53(10): 542-547.

Yildirim, M., Hettiarachchy, N. S., (1998). Properties of cast films from pickle fermentation brine protein, Journal of Agricultural and Food Chemistry, 46: 4969- 4972. doi: 10.1021/jf980487j.

Yilmaz, E., Tekinay, A. A., Çevik, N., (2006). Denizürünlerikaynaklifonksiyonelgidamaddeleri, EgeÜniversitesi Su ÜrünleriDergisi, 23(1/1): 523-527.

Yilmaz, L., AkpinarBayezit, A., ÖzcanYilsay T., (2007). Sütproteinlerininyenilebilir film vekaplamalardakullanilmasi, TeknolojikArastirmalar: GTED, 1: 59-64.

Select your language of interest to view the total content in your interested language

Viewing options

Post your comment

Share This Article

Flyer image
journal indexing image
 

Post your comment

captcha   Reload  Can't read the image? click here to refresh